KEGG   Mus caroli (Ryukyu mouse): 110308203
Entry
110308203         CDS       T05910                                 

Gene name
Erap1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110308203 (Erap1)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     110308203 (Erap1)
Peptidases and inhibitors [BR:mcal01002]
 Metallo peptidases
  Family M1
   110308203 (Erap1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 110308203
NCBI-ProteinID: XP_021036254
Ensembl: MGP_CAROLIEiJ_G0018725
Position
13
AA seq 930 aa
MPSLLPLVLTLLSVSFPSWCQNSDTASPKASNGDPFPWNNMRLPEYMTPIHYDLMIHANL
STLTFWGKTEVEITASQPTSTIIMHSHQLQISKATLRRGAGEMLSEEPLKVLEYPAHEQV
ALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEMRILAATQFEPTAARMAF
PCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIEDHFDITVKMSTYLVAFII
SDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFNIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRESALLYDKEKSSASSKLGITMTVSHELAHQWFGNLVTMEWWND
LWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEVDALNSSHPVSTPVENPAQIRE
MFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYSYKNTKNEDLWNSMMHICPTDGT
QTMDGFCSRSQHSSSASHWRQEVVDVKTMMNTWTLQKGFPLITITVRGRNVHMKQEHYMK
GSERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTDVLILPEAVQWIKFNVGMNGYYIVH
YEDDGWASLSGLLKEAHTAISSNDRASLINNAFQLVSIEKLSIEKALDLTLYLKNETEIM
PIFQALNELIPMYKLMEKRDMIEVETQFKDFLLKLLKVLIDKQTWTDEGSVSERMLRSQL
LLLACVRSYQPCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQS
SLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILILIGRNPVGYPLAWK
FLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQT
IETIEENIRWMDKNFDKLRLWLQKEKPELL
NT seq 2793 nt   +upstreamnt  +downstreamnt
atgccctctcttcttcccctagtattgacacttttatctgtgtcatttccttcttggtgt
cagaacagcgatacagcatctcccaaagctagtaatggagacccattcccttggaataat
atgcgacttcctgagtatatgaccccaattcattatgatctcatgatccatgcaaacctc
agcactctgactttctggggaaaaacagaagtagaaatcacagctagccagcccaccagc
accattattatgcatagtcaccagctgcaaatatcgaaggccaccctcagaagaggagct
ggagagatgctgtctgaagaaccactgaaggtcctggaatatcctgctcatgagcaagtt
gcactgctggctgcccagccgcttcttgctgggtccctgtacacagttatcatcgactat
gctgccaacctgtctgagagtttccatggattctataagagcacctacaggacacaggaa
ggggaaatgagaatacttgcagcaacacagtttgaacccacagctgctagaatggctttt
ccctgctttgatgaacctgccctcaaggcaagtttttccatcaagataaagagggatcca
aggcacctggccatctccaacatgcccctggtgaaatctgtgaatgttgctgaaggactc
atagaagaccattttgacatcactgtgaaaatgagtacctacctagtggccttcatcatt
tctgattttaagtctgtgagcaagatgactaagagtggagtcaaggtttctgtgtatgct
gtgccagacaagataaatcaagccgattatgctctggatgctgcagtgactcttctagag
ttttatgaggattatttcaacattccatatcctttacccaagcaagatcttgctgcaatc
ccagactttcagtctggtgctatggaaaactggggactgaccacatacagagaatccgct
ctgttatacgataaagaaaagtcttctgcatctagtaagcttggcatcacaatgactgtg
tcccatgaactggctcaccagtggttcgggaacctggtcaccatggaatggtggaatgac
ctttggctcaatgaaggatttgccaaatttatggagtttgtgtctgtcactgtgacccat
cctgaactaaaagttgaagactatttctttggcaagtgttttaatgcaatggaagttgat
gcattaaactcctctcaccctgtatccacacctgtggagaatcctgcgcagattcgggag
atgtttgatgatgtttcttatgaaaagggagcttgtattctgaatatgctaagagattat
ctgagtgcagatacattcaaaagaggaattgtacagtatctccaaaagtatagttataaa
aacacaaaaaacgaggacctgtggaatagcatgatgcatatttgccccacagatggcaca
caaacaatggatggcttctgctctagaagccaacactcatcatcagcctcacactggcgt
caggaggttgtagatgtaaagaccatgatgaacacatggacactgcagaagggctttcct
ctgataaccatcactgtgagagggcggaatgtgcacatgaagcaagaacactacatgaag
ggttcagaacgcttcccagagactgggtatttgtggcatgttccactgacattcattacc
agcaaatcagactcagtccagagatttttgctgaagacaaagacagatgtgctcatcctc
ccagaagcagtgcagtggatcaaatttaacgtgggaatgaatggctattacattgtgcat
tacgaggatgatggatgggcttctctgagtggccttttaaaagaagcacacacagcaatc
agcagtaatgatcgggcaagtctcatcaacaatgcatttcagctggtcagcattgaaaag
ttatcaatagaaaaagccctggatttaaccctgtacttgaaaaatgaaactgaaattatg
cccatattccaagctttgaatgaactcatacctatgtataagttaatggagaaaagggat
atgattgaggtggaaactcaatttaaggacttcctcctcaagttgctgaaggtccttatt
gataagcagacttggacagatgaaggctctgtctcagagaggatgctcaggagccagctc
ctcctcctcgcgtgtgtgcgcagttatcagccctgcgtgcagagggcagagcgctatttc
agagagtggaagtcatctaatggaaacatgagcatccctattgatgtgaccttggctgtg
tttgctgtcggggcccaaaacacagaaggctgggattttctttatagtaaatatcagtct
tctttgtctagtactgagaaaagccaaattgaattttccctctgtacaagcaaagatcca
gaaaaacttcagtggcttctagaccaaagttttaagggagagataataaaaactcaggaa
tttccacatattctcatactcattggcagaaacccagtgggttatccattggcctggaag
tttctgagggaaaattggaataagcttgtacagaaatttgaacttggctcatcgtccata
gctcacatggtaatgggaacaacagaccagttttccaccagagcacgtcttgaagaggta
aaaggattcttcagttccttgaaagaaaatggctctcagctccgttgtgttcaacaaacc
attgagaccattgaagaaaacatacgatggatggataagaattttgataaactaagactg
tggctgcaaaaagaaaagccagagttgctgtga

DBGET integrated database retrieval system