KEGG   Mus caroli (Ryukyu mouse): 110308273Help
Entry
110308273         CDS       T05910                                 

Gene name
Pcbd2
Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase 2 isoform X1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00790  Folate biosynthesis
mcal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110308273 (Pcbd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110308273 (Pcbd2)
Enzymes [BR:mcal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     110308273 (Pcbd2)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110308273 (Pcbd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 110308273
NCBI-ProteinID: XP_021036375
Ensembl: MGP_CAROLIEiJ_G0018576
Position
13
AA seq 136 aa AA seqDB search
MAAALAVAVAAVGARSAGRWLAALRSRGASRAAMSSDAQWLTAEERDQLIPGLKAAGWSE
LSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTK
RDVKLAQFIEKAAASL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgctggcggtggctgtagcggcggtgggagcgcgcagcgcggggcggtgg
ctggcggcgctgcgcagccggggcgcgagcagagcggccatgtcttcggatgcgcagtgg
ttgacggcagaggagagggaccaacttattcctggcttgaaagcagcagggtggtcggaa
ctgagtgagagagatgccatctacaaagagttctccttcaaaaacttcaatcaggcattt
ggctttatgtccagggttgccctgcaagcagagaagatgaatcaccacccggaatggttc
aacgtctacaacaaggtccagataaccctcacctcgcatgactgtggtggcctgaccaag
cgagatgtgaagctggcccagttcattgaaaaagctgctgcgtctctgtga

DBGET integrated database retrieval system