KEGG   Mus caroli (Ryukyu mouse): 110308553
Entry
110308553         CDS       T05910                                 

Gene name
Ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110308553 (Ahrr)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    110308553 (Ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 110308553
NCBI-ProteinID: XP_021036642
Ensembl: MGP_CAROLIEiJ_G0018718
Position
13
AA seq 701 aa
MMIPSGECTYAGRKRRKPIQKRRLTMGAEKSNPSKRHRDRLNTELDHLASLLPFSPDIIS
KLDKLSVLRLSVSYLRVKSFFQALQETCVWSAPALSPEEHSYRGFPVQEGRLLLESLNGF
ALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVF
GQSPHADTDNTVLGKLLRAQEGGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQKKKTPSGAALPPRLSLFCIVAPVLPSVTEMKMKSTFLKAKHRADIVVTMDSRA
KAVTSLCESELHPKLNYLAGRSNGENGISLFRGQTDRSHWARALARSSCLCLRGGPDLLD
PKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPVHLRHLNWSTEQRSQEGTTKL
TRQPSKNEPSTCLVPRGSCVPYPGSEGMLSASNMASFRDSLDHPTGAYCSQMNRPLPDIH
QGQVDPSTCHISQGSLGSRIPLSGMQRFTARGFSTEDAKLPSLPVTIGTPCNPVLSLDVP
IKMENESGSQDIVEASATSCVWLGTSDMARRHLVGFPARMHLKTEPDYRQQACTPHLGHG
MLGTNPYSRDTVGSCREHAPLYSAHCTCLDPEPPHHLFMCSHSESQHPSLDQDCRAPIVK
REPLDSPSWAAPGQVTVPRMFPKSASITVIPSKGSDGIFLP
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgatgattccatcaggagagtgtacatatgccggtaggaagagaaggaaacccattcag
aagcggaggcttaccatgggagctgagaaatcaaatccttccaaacggcaccgggatcgc
ctcaatacagagctggaccacctggccagcctgctgccattttcacctgatatcatctcc
aagctggacaagctttctgtcctgcgcctcagcgttagctacctcagggtaaagagcttc
ttccaagccttgcaggagacatgtgtatggtcagctccagccctgtcacctgaagaacac
tcatacagagggttccctgtgcaggaaggacggctgctgctggagtctctcaatggcttc
gctctggtggtgagtgccgaagggatgatcttttatgcatcagcaacaattgtggactat
ctgggctttcatcagacagatgtcatgcatcaaaacatttatgactacatccatgtggat
gaccggcaggacttctgcagacagctacactgggccatggaccctcctcaggtggtgttt
gggcagtccccacatgctgacacagacaatactgtcctggggaagctgctcagggcccaa
gaaggaggcaagggcttgccctcagagtactcggccttcttgacacgctgcttcatttgt
cgtgttcgctgcctgctggacagcacctctggctttctgaccatgcagttccaaggaaaa
ctaaaattcctgtttggacagaagaagaagacaccatcaggagcagccctgcctcctcga
ctctcattgttctgcatcgtggcgccagtcttgccttctgtgactgagatgaaaatgaaa
agcacattcttgaaggcaaagcacagggcagacattgtggttacgatggactcaagggca
aaagctgttacaagtctatgtgaatcagaattgcatcccaaactcaattacttagcagga
aggagcaatggagaaaatggcatttcactgttcaggggacaaacagataggagccattgg
gcccgggctctagccaggtcttcatgtctgtgcctcaggggtggtcctgacctgctggac
cccaaggggacttcaggggacagagaagaggaggaccagaagcacatactaaggagatcc
cctggtgcctgggggcagagggagatgcacaagtacagttatggtttggagacaccagta
cacttgaggcacctgaactggagcacagaacagcgaagtcaggagggcactaccaagctg
actcggcagcctagtaagaatgagccatccacatgtctggtgccccgtggttcctgtgtg
ccctaccctggaagcgagggcatgctcagtgccagcaacatggcttcttttagagattca
ctagaccatcccactggtgcctactgcagtcagatgaacagacccttgccggatatccac
cagggccaggtggatccttccacctgccatatctcccagggcagtctgggatctaggatc
cctctgtctggaatgcagcgcttcacagctaggggattttctacagaggatgcaaaattg
cccagcctgccagtgaccataggcaccccatgcaacccagtattgtcactggatgtgcca
atcaagatggagaatgaatctgggtcccaggatatagttgaagctagtgcaactagctgt
gtgtggctgggaaccagcgacatggccagaagacatctggttggtttccctgccaggatg
cacctgaaaacagagcccgactataggcagcaggcctgtaccccacaccttggtcatggt
atgctgggaactaatccctacagcagagatactgttggatcctgtagggagcatgctcct
ctttactctgcacattgcacctgcctggatccagagcctcctcatcacctcttcatgtgt
agccacagtgagagccagcacccctcattggaccaagactgcagagctcctattgttaag
cgtgagcctctggactcaccatcatgggctgctcctgggcaggtgactgtgcccaggatg
ttccctaagagtgcctctataactgtgatcccatccaaaggctctgatggaattttccta
ccctag

DBGET integrated database retrieval system