KEGG   Mus caroli (Ryukyu mouse): 110309205Help
Entry
110309205         CDS       T05910                                 

Gene name
Anxa7
Definition
(RefSeq) annexin A7
  KO
K17095  annexin A7/11
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110309205 (Anxa7)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110309205 (Anxa7)
  Exosomal proteins of other body fluids (saliva and urine)
   110309205 (Anxa7)
  Exosomal proteins of colorectal cancer cells
   110309205 (Anxa7)
  Exosomal proteins of bladder cancer cells
   110309205 (Anxa7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin
Motif
Other DBs
NCBI-GeneID: 110309205
NCBI-ProteinID: XP_021037365
Ensembl: MGP_CAROLIEiJ_G0018989
Position
14
AA seq 463 aa AA seqDB search
MSYPGYPPTGYPPFPGYPPAGQESSFPTAGQYPYPSGFPPMGGGAYPPAPSGGYPGAGGY
PAPGGYPAPGGYPGALSPGGPPAYPGGQGFGAPPGGAGFSGYPQPPAQSYGGGPAQVPVP
GGFPGGQMPSQYPGGQAPFPSQPAAMTQGTQGTILPASNFDAMRDAEILRKAMKGFGTDE
QAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPSTYYDAWS
LRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCYQLEFGRDLEKDIRSDTSGHFERLLVS
MCQGNRDERQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSR
MANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVT
RSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIVGQ
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacccaggctatccgcccactggctacccacctttccctggatatcctcctgca
ggtcaggagtcctctttccccactgcgggtcagtatccgtaccctagtggcttcccaccg
atgggaggaggtgcttacccaccagcaccaagtggtggctatccaggagctggaggctac
cccgcacctggaggttatccagcccctgggggctatcctggagccctaagtccagggggt
cctccagcctatcctggaggccaaggctttggggccccacccggtggagcaggcttttct
ggctatccacagccacctgcacagtcttacggtggcggaccagcccaggttccagtacca
ggtggctttcctggaggacagatgccatctcagtaccctggaggacaagctcccttccct
agccagcctgctgcgatgactcaaggcacccaaggaacaatcctcccagcctccaacttt
gatgctatgagagatgcagaaattctccgcaaagcaatgaaagggtttgggacagacgag
caagcaattgtggatgttgtgtctaaccgttccaatgaccagaggcaacaaatcaaagca
gcttttaagaccatgtatggaaaggatttaattaaagatctcaagtcagaattgagtggg
aatatggaagaattaatccttgcgctgttcatgccttctacatactatgatgcctggagc
ttacggaaggcaatgcagggagcaggaactcaagaacgtgtattgatagagattttgtgc
acaagaacaaatcaagaaattcgagacattgttagatgttatcaattggaatttggacga
gaccttgagaaggacattaggtcagatacctcgggacattttgaacgtctcctcgtgtcc
atgtgccagggaaaccgtgacgagaggcagagtgtgaaccaccagatggcccaggaggac
gctcagcgtctctatcaggctggggaggggagactgggaacggatgaatcctgtttcaac
atgattctcgccacaaggagcttccctcagctgaaggccactatggaggcttattccagg
atggctaatcgagatttgctaagcagtgtaagccgagaattttctggatacgttgaaagt
ggtttgaagaccatcttgcagtgcgccctcaaccgccctgccttctttgctgaacgactc
tactattccatgaaaggcgctggcacggacgactccaccctggtcaggattgtggtcact
cgaagtgagattgaccttgttcagataaaacagatgttcacccagatgtatcagaagacc
ctaagcacaatgatcgcaagtgacacgagtggagattacaggaagctgctcctggccatt
gttggccagtga

DBGET integrated database retrieval system