KEGG   Mus caroli (Ryukyu mouse): 110309571Help
Entry
110309571         CDS       T05910                                 

Gene name
Ltb4r
Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110309571 (Ltb4r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcal04030]
    110309571 (Ltb4r)
G protein-coupled receptors [BR:mcal04030]
 Rhodopsin family
  Lipid
   Leukotriene
    110309571 (Ltb4r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srv 7tm_4 DUF3742
Motif
Other DBs
NCBI-GeneID: 110309571
NCBI-ProteinID: XP_021037964
Ensembl: MGP_CAROLIEiJ_G0019318
Position
14
AA seq 351 aa AA seqDB search
MAANTTSPAAPSSPGGMSLSLLPIVLLSVALAVGLPGNSFVVWSILKRMQKRSVTALLVL
NLALADLAVLLTAPFFLHFLARGTWSFREMGCRLCHYVCGISMYASVLLITIMSLDRSLA
VARPFMSQKVRTKAFARWVLAGIWVVSFLLAIPVLVYRTVKWNNRTLICAPNYPNKEHKV
FHLLFEAITGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHL
VNLVEAGRTVAGWDKNSPAGQRLRLARYVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VVKLLEGTGSEVSSTRRGGTLVQTPKDTPACPEPGPTDSFMTSSTIPESSK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaacactacatctcctgcagcaccttcttctcctggtggcatgtccctgtct
ctgttgcccattgttctactgtctgtggccctggctgtggggcttcctggcaatagcttt
gtagtgtggagcatcctgaaaaggatgcagaaacgctcggtcaccgccctgctggtgctg
aacttggccctggccgacttggctgtgttgctcactgctccctttttcctccactttctg
gctcgaggcacctggagttttagagagatgggttgccgcctgtgccactatgtctgtgga
ataagcatgtatgccagtgtcctgcttatcaccatcatgagtctggaccgctcactggca
gtggcccgcccctttatgtcccaaaaggttcgtactaaggcctttgcccgatgggtgctg
gcaggcatctgggtggtgtcttttctgctggccataccggtccttgtgtaccgtacagta
aaatggaacaacaggactctgatctgcgctccgaactatcccaacaaagagcataaagtc
ttccatctgctcttcgaagccatcacgggcttcctgctgcccttcctagcggtggtggcc
agctactctgacatcgggcgcaggctgcaggctcggcgcttccgccgtagtcgccgcacc
ggccgcctggtggtgctcattatcctggccttcgccgccttctggctgccttaccacctg
gtgaacctggtggaagccggccgcacagtggccggctgggacaagaacagccctgcgggg
cagcgtctgaggctggcccgctatgtgctcatcgcgctggccttcctgagcagcagcgtg
aacccggtgctgtacgcgtgcgcgggcggcggcctgctgcgttcggcgggcgtgggcttc
gtggtcaagctactggagggcactggctcggaggtgtccagcacccgccgcgggggcact
ctggtccagaccccgaaggacacacctgcctgtcctgagcctggccccaccgacagcttc
atgacttcttccaccattcctgagtcttcgaagtga

DBGET integrated database retrieval system