KEGG   Mus caroli (Ryukyu mouse): 110310116Help
Entry
110310116         CDS       T05910                                 

Gene name
Cacna1i
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04020  Calcium signaling pathway
mcal04713  Circadian entrainment
mcal04925  Aldosterone synthesis and secretion
mcal04927  Cortisol synthesis and secretion
mcal04929  GnRH secretion
mcal04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110310116 (Cacna1i)
   04020 Calcium signaling pathway
    110310116 (Cacna1i)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    110310116 (Cacna1i)
   04925 Aldosterone synthesis and secretion
    110310116 (Cacna1i)
   04927 Cortisol synthesis and secretion
    110310116 (Cacna1i)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110310116 (Cacna1i)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110310116 (Cacna1i)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcal04040]
    110310116 (Cacna1i)
Ion channels [BR:mcal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110310116 (Cacna1i)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 110310116
NCBI-ProteinID: XP_021038464
Ensembl: MGP_CAROLIEiJ_G0020039
Position
15
AA seq 2199 aa AA seqDB search
MADSNLPPSSAAAPDPEPGITEQPGPRSPPPSPPGLEEPLDGTNPDVPHPDLAPVAFFCL
RQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMECLSDRCKILQVFDDFI
FIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRV
LRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLE
ENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDMYD
FGAGRQDLNASGLCVNWNRYYNVCRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEI
MYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYLSS
STVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQNRRQATGPGTPAPAKPGPHAK
EPSHCKLCPRHSPLDTTPHTLVQPISAILASDPSSCPRCQHEAGRRPSGLGSTDSGQEGS
GSGGSAEAEANGDGPQSSEDGVSSGLGKEEEQEDGAARLCGDVWRETRAKLRGIVDSKYF
NRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRN
PYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNV
ATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQED
WNVVLYNGMASTTPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSS
SNLEELDKLPEGLDSSRDLKLCPIPMTPNGHLDPSLPLGGHLGPAGAMGAAPRLSLQPDP
VLVALESRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSGTWASRRSSWNSLKHKPPSAE
HESLLSGERGGSCVRACEGAREDAPPRAAPLHAPHTHHAHHGPHLAHRHRHHRRTLSLDT
RDSVDLAELVPVVGAHSRAAWRAAGQAPGHEDCNGRMPNIAKDVFTKMDDRRDRGEDEEE
IDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENKFRILCQTIIAHKLFDYVVLAFIF
LNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAYLRSSWN
VLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLIS
SLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYRWVHHKY
NFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLLYFISFLLIVSFF
VLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCPTRLLIH
SMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAVLKLVAF
GLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARVLKLLKM
ATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGMSRHATF
ENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVLTAQFVL
INVVVAVLMKHLDDSNKEAQEDAEMDAEIELEMAHGLGPGPGPCPCPCPCPCPCPCPGPR
MPTSSPGAPGRGSGGAGVGGDTESHLCRHCYSPAQETLWLDSVSLIIKDSLEGELTIIDN
LSGSIFHHYSSPAGCGKCHHDKQEVQLAETEAFSLNSDRSSSVLLGDDLSLEDPTACPQG
PKESKGELEPPEPMQAGDLDECFFPFASDPVSAGPESLLCEMGAIPFNPVQSWLKHESNQ
APPSPFSPDGSSPLLQMPAEFFHPAVSASQKGQEPGMSSGTLPKIALQGSWASLRSPSVN
CTLLRQATVSDTSLDASPSSSAGSLQTTLEDSLTLSDSPRRALGPPVQVPGPRASLSPAT
RRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTYHDSMDPSDEEGRGGAGGGGAGSEH
SETLSSLSLTSLFCLPPTLPPPGLTPARKFSSTSSLAAGPGRPGATVSVRGLARSPSWAA
DRSKDPPGQAQLASGLGSSAPEPQPPPGESTDAASKRKR
NT seq 6600 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagcaacttaccaccctcatctgcagcagccccggaccctgagccgggaatc
actgagcagccggggccccggagtccccctccatcccctccaggcctggaggagccattg
gatggaaccaaccctgacgtcccgcatccagacctggcacccgttgccttcttctgcctg
cgccagaccacgagcccacggaactggtgcatcaagatggtatgtaacccgtggttcgag
tgtgtgagcatgctggtcatcctgctgaactgtgtgaccctgggcatgtaccagccgtgt
gacgacatggagtgcctctcagaccgctgcaagatcctgcaggtctttgatgacttcatc
ttcatcttcttcgccatggagatggtgcttaagatggtggccctgggcatttttggcaag
aagtgctacctcggggacacatggaaccgcttggacttcttcattgtcatggcagggatg
gtcgaatactctctggacctacagaacatcaacctgtcagccatccgcactgtgcgtgtc
ctgaggcctctcaaagccatcaaccgtgttcccagcatgcggattctggtgaacctgctg
ctggacacgctgcccatgctgggaaatgtgctcctgctctgttttttcgtcttcttcatc
tttggcatcatcggcgtgcagctctgggcaggcctgctgcggaaccgctgcttcctggag
gagaacttcaccatacaaggggacgtggccctgcccccttactaccaaccagaggaggat
gacgagatgcccttcatctgctccctgtctggggacaatggcattatgggctgccacgag
atccctccacttaaggagcagggccgagagtgctgcctgtccaaagatgacatgtacgac
ttcggggcgggacgccaagacctcaacgccagcggcctctgtgtcaactggaatcgctac
tacaacgtctgccgcacgggcaatgccaaccctcacaagggcgccatcaactttgacaac
attggctatgcctggatcgtgatctttcaggtgatcactctggaaggctgggtggagatc
atgtactacgtgatggatgcgcattctttctacaacttcatctacttcatcctgctcatc
atagtgggctccttcttcatgatcaatctgtgcctcgttgtcatagcgacccagttctcc
gagaccaagcaacgggagcaccggttgatgctggagcaacgccagcgctacctgtcctcc
agcacggtggccagttacgccgagcccggcgactgctatgaggagatcttccaatatgtc
tgtcacatccttcgcaaggccaagcgccgtgctctgggcctctaccaggccctgcagaac
cggcgccaggccacgggcccggggacaccagcccctgccaagcctgggccccatgccaag
gagcccagccactgcaagctgtgcccacgacacagtcccctggacaccactccccacaca
ctggtgcagcccatctctgccattctggcctccgaccccagcagctgccctcgctgccag
cacgaggcaggcaggcggccctctggcctgggcagcactgactcgggccaggaaggctca
ggttctggcggctctgcagaggccgaagccaatggcgatggaccccaaagcagtgaggac
ggggtctcttcaggtttggggaaggaggaggaacaggaggatggggcagcccgactgtgt
ggggatgtgtggcgagagacacgggccaagctgcggggcatcgtggacagcaagtacttc
aacagaggcatcatgatggctattctggttaacactgtcagcatgggcatcgagcaccat
gaacagccagaggaactgaccaacatcctggagatctgcaacgtggtcttcaccagcatg
tttgccctggagatgattctgaagctggctgcctttgggctctttgactacctgcggaac
ccttacaacatcttcgacagcatcattgtcatcatcagcatctgggaaatcgtggggcag
gctgacggtggcctgtccgtgctgcgcaccttccggctgctgcgggtgctgaagctggtg
cgcttcatgccggcgctgcggcgccagctcgtggtgctcatgaagaccatggacaacgtg
gccaccttctgcatgctgctcatgctcttcatcttcatcttcagcatccttgggatgcat
atctttggctgcaaattcagcctccgcacggacactggagacacagtccctgacaggaag
aacttcgattccttactgtgggccatcgtcaccgtgtttcagatcctcactcaggaggac
tggaacgttgtcctgtacaatggcatggcctccaccaccccctgggcctccctctatttt
gttgccctcatgacctttggcaattatgttctcttcaatctcctggtggctatcctggtc
gagggcttccaggctgagggtgacgctaatcgctcctactcagatgaggaccagagctca
tccaacttggaggagcttgataagctcccagagggcctggacagcagcagagatctcaag
ctctgcccaatacccatgacacccaatggacacctggaccctagcctccctctgggtgga
catctgggtcctgctggtgccatgggtgctgccccccgcctctcactgcagccagaccca
gtgctggtggccctagaatcccggaaaagcagtgtcatgtcactgggcaggatgagctat
gatcagcgatccttgtccagctcccggagctcctactatgggccctggggccgcagcggg
acctgggccagccgccgctccagctggaacagcttgaaacacaagccaccctcagctgag
cacgagtccctgctctccggggagcgtggtggtagctgcgtcagggcctgtgaaggcgcc
cgggaggatgcgccacctcgcgctgcacccctgcatgccccgcacacccaccatgcgcac
catggaccccacttggcacaccgtcaccgccaccaccgtcggacactgtccctcgatacc
agggactctgttgacctggcagagctggtgcccgtggtgggtgcccactcgcgggctgct
tggagggcggcgggccaggcccctggacacgaggactgcaatggcagaatgcccaacata
gccaaggatgtcttcaccaagatggacgaccgccgcgaccgtggggaggacgaggaggag
atcgactacaccctgtgtttccgcgtccgcaagatgattgatgtgtacaagcctgactgg
tgcgaagtccgcgaggactggtcggtctacctcttctcccctgagaacaagttccggatc
ctgtgtcagaccattattgctcacaagctttttgactacgtggtcttggccttcatcttc
ctcaactgtatcaccattgctctggagaggccccagattgaagctggtagcactgagcgc
atcttcctcacggtgtctaactacatcttcacagccatctttgtgggcgagatgacactg
aaggtggtctctctgggcctgtacttcggtgagcaagcgtacttgcgtagcagctggaac
gtcctggatggtttcctggtctttgtgtccatcatcgatatcgtggtatccgtggcctct
gcggggggagccaagatcctgggggtcctccgggtcctgcggctcctgcgtaccttacgt
cctttgagggtcattagccgggcccctgggctgaagctggtggtagagacacttatctcc
tccctcaagcccatcgggaacattgtcctcatctgctgcgccttcttcatcatctttggc
atcctgggggtgcagcttttcaaaggcaagttctatcactgtctgggagtggacacccga
aacatcaccaaccgatcagactgcgtggccgccaactaccgctgggtgcatcacaaatac
aactttgataacctgggccaggctttgatgtccctctttgtcttggcctccaaggatggc
tgggtgaacatcatgtataatggattggatgctgttgctgtggaccagcagccggtgaca
aaccacaacccctggatgctgctgtacttcatctccttcctgctcattgtcagcttcttc
gtgctcaacatgtttgtgggcgtggtcgtggagaacttccacaagtgccggcagcatcag
gaggctgaggaggcacggcggcgcgaggagaaacggctacggcgcctggaaaagaagcgc
cgtaaggctcagaggctgccctactatgccacctactgtcccacaaggctgctcatccac
tccatgtgcactagccactacctggacatcttcatcaccttcatcatctgcctcaacgtg
gtcaccatgtccctggagcactacaaccagcctacatccctagagacagccctcaagtac
tgcaactacatgttcaccactgtctttgtgctggaggctgtgctgaagctggtggcgttt
ggcctgaggcgtttcttcaaggaccgatggaaccagctggacctggccattgtgctgctg
tctgtcatgggcatcacactggaggagattgagatcaatgcggccctgcccatcaacccc
accatcatccgtatcatgcgtgttctgcgtattgcccgggtgttgaagctgttgaagatg
gccacaggaatgcgggccctgctggacacagtggtacaagctctgccccaggtgggcaac
ctgggcctcctcttcatgctgctcttcttcatctacgccgctctgggagtggagctcttc
ggaaagctggtctgcaatgatgagaacccgtgtgagggcatgagccggcacgccaccttt
gagaacttcggcatggccttcctcacactcttccaggtctccacaggcgataactggaac
gggattatgaaggacactctgcgagactgcacccacgatgagcgcagctgcctgagcagc
ctgcagtttgtgtcgcctctctactttgtgagcttcgtactcacagcgcagtttgtgctc
atcaatgtggtggtggccgtgctgatgaaacatctggatgacagcaacaaggaggcccag
gaggatgcagagatggatgctgagatcgagctggagatggcccatggcctaggccctggg
cccggcccctgtccctgtccctgtccctgcccctgcccctgtccctgtcctggcccgagg
atgcccaccagttcaccgggggctccaggccgaggatcaggaggggcaggcgttggaggc
gacactgagagccacctgtgccggcactgctattctccagcccaggagaccctgtggctg
gacagcgtctctttaatcatcaaggactccttggagggggagctgaccatcattgacaac
ctgtctggctccatcttccaccactactcctcacctgccggctgtggcaagtgtcaccat
gacaagcaagaggtgcagctggctgagacagaggccttctccctgaactcagacaggtcc
tcgtccgtcctgctgggggatgacctgagtcttgaggaccccacggcctgcccgcagggc
cccaaggagagtaagggtgagctagagcctccggagcccatgcaggctggagacctggat
gaatgctttttcccctttgccagtgatccagtgtctgcaggcccagagagcctgctgtgc
gagatgggggccattccattcaaccccgtccagtcctggctcaaacatgagagcaaccaa
gcacccccaagccctttctccccggatggttccagccctctgctgcagatgcctgctgag
ttcttccaccctgctgtgtctgccagccagaaggggcaggaaccgggcatgagttcaggg
accctgcccaagattgcacttcaggggtcctgggcatccctgaggtcaccgagcgtcaac
tgcaccctcttgcgccaggctactgtgagtgacacgtctttggatgccagccctagcagc
tcagcgggcagcctgcagaccacactggaggacagtttgaccctgagtgacagtcctcgg
cgtgccctgggaccaccagtccaggtgccagggccacgggctagcctgtcacctgccacc
cggcgccgcctcagcctgcgggggcgtggcctatttagtctgcgtgggttgcgggcccat
cagcgtagccacagcagcggtggctccaccagccctggctgcacttaccacgactccatg
gacccctccgatgaggagggccgcgggggcgcaggtggtgggggcgcaggcagtgagcac
tccgagaccctcagcagcctgtcacttacatctctcttctgcctaccacccacgctgcca
ccacccggcctcaccccagccaggaagttcagcagtaccagcagcctggctgctggacct
ggccgtcctggcgccactgtctccgtccgtggcctggccaggagtccctcatgggctgca
gaccgcagcaaggacccaccaggccaggcacagctggcctccggcttgggctcctcagca
cccgagccacagccacctcccggggagtcaacggatgcagcgagcaaaaggaagagatga

DBGET integrated database retrieval system