KEGG   Mus caroli (Ryukyu mouse): 110311067Help
Entry
110311067         CDS       T05910                                 

Gene name
Cpt1b
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal00071  Fatty acid degradation
mcal01212  Fatty acid metabolism
mcal03320  PPAR signaling pathway
mcal04152  AMPK signaling pathway
mcal04714  Thermogenesis
mcal04920  Adipocytokine signaling pathway
mcal04922  Glucagon signaling pathway
mcal04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110311067 (Cpt1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    110311067 (Cpt1b)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110311067 (Cpt1b)
   04920 Adipocytokine signaling pathway
    110311067 (Cpt1b)
   03320 PPAR signaling pathway
    110311067 (Cpt1b)
  09159 Environmental adaptation
   04714 Thermogenesis
    110311067 (Cpt1b)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110311067 (Cpt1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110311067 (Cpt1b)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     110311067 (Cpt1b)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    110311067 (Cpt1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 110311067
NCBI-ProteinID: XP_021039954
Ensembl: MGP_CAROLIEiJ_G0020170
Position
15
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPDGFDFRLSREALRHIYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATVGSNYCKVDISMGLVDCIQRCLPERYGHFGTPQTETLLSMVIFSTGVWATG
IFFFRQTLKLLLSYHGWMFEMHSKTSHATKIWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATIHRYLDSVRPLLDDEAYYRMETLAKEFQDKTAPRLQKYLVLKSWWATNYVSDWWEE
YVYLRSRSPLMVNSNYYAMDFVLIKNTNVQAARLGNAVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKETDLLQHLSESRHVAVYHKGRFFKVWLYEGSRLLKPRDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAEARQTFFSSGKNKMSLDAIERAAFFVT
LDEDSHCYNPDDETSLSLYGKALLHGNCYNRWFDKSFTLISCKNGLLGLNTEHSWADAPI
IGHLWEFVLGTDTFHLGYTETGHCVGEPNTTLPPPQRLPWDIPEQCREAIENSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDKGKFCLTYEASMTRMFREG
RTETVRSCTNESAAFVQAMMKGSHKKQDLQDLFRKASEKHQNMYRLAMTGAGIDRHLFCL
YIVSKYLGVSSPFLAEVLSEPWSLSTSQIPQFQICMFDPKQYPNHLGAGGGFGPVADDGY
GVSYMIAGENTMFFHISSKYSSSETNAQRFGNHIRQALLDIAELFKISKTDS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcacaccaggcagtagctttccagttcactgtgaccccagatgggttcgac
ttccggcttagtcgggaggctctgagacacatctacctgtctggaatcaactcctggaag
aaacgccttattcgaatcaagaatggcatccttaggggtgtgtaccctggcagccccacc
agctggctggttgttgtcatggcaacagttggttccaactactgcaaggtggacatctcc
atgggactggtcgattgcattcagagatgcctcccagaaaggtatggccactttgggacc
ccacagacggagacacttctcagcatggtcatcttctccaccggagtctgggcgacaggc
attttcttcttccgacaaaccctgaagctgctgctctcctaccatgggtggatgtttgag
atgcacagcaagaccagccatgccaccaagatctgggctatctgtgtccgtctcctgtcc
agccggcggcccatgctctacagcttccaaacatcactgcctaagcttcctgtccccagc
gtgccagccacaattcaccggtacttggattctgtgcggcccttattggatgatgaagca
tattaccgcatggagacattggccaaggaattccaggacaagactgcccccaggctgcag
aaatacctggtgctcaagtcatggtgggcaactaactatgtgagtgactggtgggaagaa
tacgtctacctccgaagcaggagccccctcatggtgaacagcaactattatgccatggat
tttgtgcttattaagaacacaaatgtgcaagcagcccgtctgggcaatgccgttcacgcc
atgatcatgtatcgccgcaaactggaccgtgaagagatcaagccggtcatggcactgggt
atggtgcccatgtgctcctaccagatggagaggatgttcaacactacacgcatcccaggc
aaagagacagacttgctacagcacctctcagagagcaggcacgtggctgtctaccacaaa
ggtcgcttcttcaaggtctggctctacgagggctcgcgcctgctcaagccccgagacctg
gagatgcagttccagagaatcctcgatgacccttccccacctcagcccggggaggagaag
ctggcagccctcaccgcaggaggaagggtagagtgggcagaggcacgtcagaccttcttc
agctctggcaagaacaagatgtctctggacgccatcgagcgtgctgctttctttgtgacc
ctggatgaagattctcactgctacaaccctgacgatgagaccagccttagcctctacggc
aaagccttgctgcatggtaactgctataacaggtggtttgacaaatctttcactcttatc
tcctgcaagaatggcctgttaggcctcaacaccgaacactcgtgggcagatgcgccaatc
attgggcacctctgggagtttgtcctgggcactgatacctttcacctgggctacacggag
acaggacactgtgtgggtgagccaaacaccacgttgccaccccctcagcggctgccgtgg
gacattcccgagcagtgccgggaagccatcgagaactcgtaccaagtagccaaggcactg
gccgatgacgtggagctctactgtttccagttcttaccctttggcaaaggccttatcaag
aagtgtaggaccagccctgacgcttttgtgcagattgccctacagctggctcattttcgg
gacaaaggcaagttctgcctgacttacgaggcctcgatgacaagaatgttccgagagggg
cggactgagaccgtgcgttcctgtaccaacgagtccgcagcctttgtgcaggccatgatg
aaggggtcccataagaaacaagacctccaagatctcttccggaaagcctccgaaaagcac
caaaacatgtaccgcctagccatgacaggggctgggatcgacaggcacctcttctgcctt
tacatcgtctccaagtacttaggagttagctctcctttcctggctgaggtactttctgaa
ccctggagcctctccaccagccagatcccccagttccagatctgcatgtttgacccaaaa
cagtatcccaatcatctgggtgctggaggtggctttggtcccgtggcggatgatggctac
ggggtctcttacatgattgcaggagaaaacaccatgttcttccatatctccagcaagtac
tcaagttcagagacgaacgcccagcgctttgggaaccacatccgccaagcactgttggac
atcgccgaacttttcaaaatttccaagacggacagctga

DBGET integrated database retrieval system