KEGG   Mus caroli (Ryukyu mouse): 110311599Help
Entry
110311599         CDS       T05910                                 

Gene name
Zdhhc8
Definition
(RefSeq) probable palmitoyltransferase ZDHHC8 isoform X1
  KO
K20030  palmitoyltransferase ZDHHC5/8 [EC:2.3.1.225]
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110311599 (Zdhhc8)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110311599 (Zdhhc8)
Membrane trafficking [BR:mcal04131]
 Protein recycling
  Others
   GRIP associated proteins
    110311599 (Zdhhc8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 110311599
NCBI-ProteinID: XP_021040648
Ensembl: MGP_CAROLIEiJ_G0020539
Position
16
AA seq 762 aa AA seqDB search
MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAIPVYNGILFLFVLA
NFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHC
SVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLLSLSAHMVGVVAFGLLYVLNHSEGLGA
AHTTITMAVMCVAGLFFIPVIGLTGFHVVLVTRGRTTNEQVTGKFRGGVNPFTRGCYGNV
EHVLCSPLAPRYVVEPPRMPLSVSLKPPFLRPELLERAVPLKVKLSDNGLKAGRSKSKGS
LDQLDEKPLDLGPPLPPKIEAGTFGRDLKTPRPGSAESALSVQRTSPPTPAMYKFRPAFS
TGPKTPFCGPNEQVPGPDSLTLADDSTHSLDFVSEPSLDLPDHGPGGLHPPYPPSPPLNT
TDAFSGALRSLSLKAASRRGGDHMTLQPLRSEGGPPTPHRSLFAPHALPNRNGSLSYDSL
LNPGSPSGHACPTHPSVGMASYHSPYLHPGPSDPPRPPPRSFSPVLGPRPREPSPVRYDN
LSRTIMASIQERKDREERERLLRSQTDSLFGDSGVYDTPSSYSLQQASVLTEGPRGSVLR
YGSRDDLVAGPGFGGARNPALQTSLSSLSSSMSRAPRTSSSSLQADQANNNAPGPRPGSG
SHRSPARQGLPSPPGTPRSPSYTGSKAVAFIHTDLPDRQPSLAMQRDHPQLKTPPSKLNG
QSPGMARLGPAASPLGPNASPARHTLVKKVSGVGGTTYEISV
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcagccccgggacgcgcctcaaacccgccaagtacatcccggtggccacggcc
gccgcgctgttggttggctccagcacactcttcttcgtattcacgtgcccatggttgaca
agagctgtgtctccagctattcctgtctacaatggcatcctcttcctctttgtcctggcc
aacttcagtatggctaccttcatggaccctggagtcttcccccgagcggacgaggacgag
gacaaggaggatgacttccgggccccattgtacaagaatgtggatgttcggggcatccag
gtccgcatgaagtggtgtgcaacgtgccacttttaccgtccaccgcgctgctcacactgc
agcgtctgtgacaactgtgtggaggactttgaccatcactgcccctgggtcaacaactgc
attggacgccgcaactaccgttacttcttcctgttcctgctgtcactcagcgcacacatg
gtgggggtggtggccttcggcctgctgtatgtgctcaatcactcagaggggctaggagcc
gcccacaccaccatcaccatggctgtcatgtgtgtggctggccttttcttcattcctgtc
atcggcctcactggcttccacgtggtactggtcacgcggggccgcaccaccaatgagcag
gtgactgggaagttccgcgggggtgtgaatcccttcacccgaggctgctatgggaacgtg
gagcacgtgttatgcagtcccctggcgccccggtatgtggtggaaccccccaggatgcca
ctctcagtgagcctcaagccacccttcctgagacctgagctcctggaacgagctgtgccc
ctcaaggtcaaactgagcgacaatgggctgaaagctggccgcagcaagtccaagggcagt
ctagaccagctggatgagaaacctctggacctgggacctccactgccccccaagatagag
gctggtacctttggaagagatctgaagaccccaagacctggcagtgctgagagtgcccta
tcagtacagaggaccagccccccaacacctgccatgtataagttccggccagccttctcc
actggtcccaagacacccttttgtggacctaatgagcaggtcccaggtcctgactccctt
actctggcagatgacagcacccacagtctagactttgtgtctgagcccagcctggatctc
ccagaccacgggccgggtggtctgcatcctccctaccccccctccccacccctcaacacc
actgatgccttctcaggtgccttgcgctccctgagtctcaaggctgccagtcggaggggt
ggggaccacatgaccttacagccactgcgctctgaaggtgggcccccgacacctcaccgt
agtctctttgctcctcatgcactgcccaatcgaaatggcagcctgtcatatgacagccta
cttaaccctggctcacccagtggccacgcatgccccacacacccctctgttggtatggcc
agctaccattcaccctacctgcaccctgggccatcagatccacctcggcccccaccccgc
agcttcagccctgtgctgggtccccggcctagggagccctctcctgtgcgctatgacaac
ctgtctcggaccatcatggcctctatccaggagcgcaaggacagggaagagcgtgaacgg
ctgctgcgctcccagactgactcactctttggcgactctggtgtctatgatacacccagc
tcctacagcctgcaacaggccagtgtgttaacggaaggcccccgtggctctgtcctgcgt
tacggctccagggatgacctcgtggccgggcctggctttggtggtgcccgcaatcctgcc
ctgcagacatcattgtcctcgttgtccagctccatgagtcgggcacctcggacatcttcc
tcctccctgcaggctgaccaggccaacaacaatgccccaggaccccggcctggcagtggt
tcacataggtcacctgcccgtcagggcctgccttccccaccaggcaccccccgatcgccc
tcctacacgggctccaaggctgtcgccttcatccacacggacctcccggaccggcagccc
tcactggctatgcagagggatcaccctcagctgaagacccccccaagtaagcttaacggg
cagtccccaggcatggcccgtctggggcctgctgccagccccctggggcccaacgccagc
cctgcccggcacacgctggttaagaaggtgtccggcgtgggtgggactacgtatgaaatc
tcggtgtga

DBGET integrated database retrieval system