KEGG   Mus caroli (Ryukyu mouse): 110312498
Entry
110312498         CDS       T05910                                 

Gene name
Adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110312498 (Adamts13)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     110312498 (Adamts13)
Peptidases and inhibitors [BR:mcal01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   110312498 (Adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 Peptidase_M10 Reprolysin_2 TSP1_CCN
Other DBs
NCBI-GeneID: 110312498
NCBI-ProteinID: XP_021041805
Ensembl: MGP_CAROLIEiJ_G0023333
UniProt: A0A6P5RFE1
Position
2
AA seq 1426 aa
MSQLCLWLTCQPCYAVSVRGILTGAIFILGCWGLSDFQKSLLQDLEPKDASSYFDHHAAP
LTGHPPSHLQRLRRRRTLEDILHLELLVAVGPDVSQAHQEDTERYVLTNLNIGSELLRNP
SLGVQFQVHLVKLITLSDSESTPNITANITSSLMSVCEWSQTINPHDDSDPSHADLILYI
TRFDLELPDGNQQVRGVTQLGGACSLSWSCLITEDTGFDLGVTIAHEIGHSFGLDHDGAP
GSGSTCKASGHVMASDGTAPTGGTLEWSACSQRQLQHLLSTGQMHCFQDPPGLQSGLTWH
QLMAQPGLYYSADDQCRVAFGSGAVACTFSREGLDVCQALSCHTDPLDQSSCSRLLVPLL
DGTECGVEKWCSKARCRSLAELAPVAAVHGHWSSWGPHSPCSRSCGGGVITRRRWCNNPR
PAFGGRACVGEDLQAKMCNTQACEKTQLEFMSEQCAQTDRQPLQLSQGTASFYHWDAAVQ
YSQGDTLCRHMCWAVGESFIVSRGDRFLDGTRCVPSGPQEDGTLSLCLLGSCRTFGCDGR
MDSQQVWDACQVCGGDNSTCSSQNGSFTAGRAREYVTFLIVTPNMTSAHIVNRRPLFTHL
AVRIQGHYIVAGKTSISPNTTYPSLLEDYRVEYRVTLTEDQLPHLEEIHIRGPVRDDIEI
QVYRRYGGEYGDLTHPDITFTYFQLKQQAAWVWTAKRGPCSVSCGAGLRWVTYSCQDQAQ
DKWVKNVQCQGSPQPPAWQEPCVSAPCSPYWVAGDFSPCSVSCGGGLRERSLRCVETQDG
FLKTLPPARCRAVAQQPAAEVENCNSQPCPTRWEVSDPGPCMSSACEAGLDSRNVTCVSR
AGDPEKPETAGPCRTDETSAMPEPCFRSLCSPGLGQVNYTMSLGEEAPSPVGSDKPGAQA
EHVWTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPA
RWETQALAPCPMTCGGGRVPLAVRCVQLDHGHPVSVPHSKCWPVPRPGSFEDCSPEPCPA
RWKVLSLGPCSASCGLGIATQMVACMQFDQGHDKEMNETFCKALVRPQASVPCLIADCAF
RWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPDNFCQHLPKPVTVRGCWAGPCVGQE
TSSSLPHKEATLPSQTQAAVTVASLQWSEPQAQTRTLFSASQSLGLQENLEEHGACGRQY
LEPTGTIHMRDQGRLDCVVAIGRPLGEVVTLQILESSLKCSAGEQLLLWGRFTWRKTCRK
MPGMTFSTKTNTVVVKQHRVLPGGGVLLRYWSQPAPGTFYKECDRQLFGPRGEIVSPPLS
PDGRKAGTCRVFISVAPQARIAIRALASDMSTASEGTNANYVSIRDIHSLRTTTFWGQQV
LYWESEGSEAELEFSPGFLEAHASLQGQYWAISSRTSEQDDSLALS
NT seq 4281 nt   +upstreamnt  +downstreamnt
atgagccagctttgcctgtggttgacgtgccagccttgttatgctgtcagtgtcagagga
atcctcactggtgccatcttcattctgggctgctgggggctctctgatttccagaagagt
cttcttcaagatctggagcccaaggacgcatcttcttactttgaccaccatgctgctcca
ctcacaggccatcctccctctcacctccagagactgagacggagaaggactttggaggac
attctgcacctggaactcctggtagctgtgggccccgatgtttcccaggctcaccaggag
gacacagaacgctacgtgctcactaatctcaatatcgggtcagaactgttgagaaaccca
tccctgggagttcagttccaggtgcacctggtgaaactgatcaccctctccgactcagag
agtactccgaatatcacggccaacatcacctcatccttgatgagtgtctgcgagtggagc
cagaccatcaacccccacgatgacagcgatccaagtcacgctgacctgattctctatata
accaggtttgacctggagttgcctgatggtaaccagcaggttcggggtgtcacccagctg
ggaggtgcctgctccctttcctggagttgccttatcactgaggatactggctttgacctg
ggggtcaccatcgcccatgagattgggcacagcttcgggctggaccatgacggtgctcca
ggtagtggcagcacctgcaaggccagtggccacgtgatggcgtctgatggcacagcacct
actggagggaccctggagtggtctgcctgcagccaaaggcagttgcagcacctactcagc
acagggcaaatgcactgcttccaggacccacctgggctgcagtcaggacttacatggcac
cagctgatggcacagcctggcctctactacagtgcagatgatcagtgccgtgtggctttt
ggttctggggctgtcgcctgcaccttctccagggagggtctggatgtatgccaggctctg
tcctgccacacagaccccttggaccaaagcagctgcagccgcctccttgttcctctcctg
gatgggacagaatgtggtgtggagaagtggtgctccaaggctcgctgtcgctccctagct
gagctggctcccgtggctgcagtacatggacactggtctagctggggcccccatagtccc
tgctcccgatcctgtggaggaggtgtgattaccaggaggcggtggtgcaacaaccccagg
cctgcatttgggggacgtgcatgtgtgggtgaagacctccaggctaagatgtgcaacacg
caggcttgtgagaagactcagctggagttcatgtccgagcagtgtgcccagacagacaga
caaccactgcaactttcccaaggcactgcctccttctaccattgggatgctgctgtgcag
tatagtcaaggagataccctgtgcagacacatgtgctgggctgtcggagaaagcttcatt
gtcagccgtggggacaggttcctagatgggacccgttgtgtgccaagtggtcctcaggag
gatgggaccctaagcctctgtttgttgggcagctgcaggacctttggctgtgatggcagg
atggactcccagcaggtttgggatgcgtgccaggtgtgtggaggagacaacagcacctgc
agctcacagaatggttctttcacagctgggagagccagagaatatgtcacgttcctgatt
gttactcccaacatgaccagcgcacacattgtcaaccgcaggcctctcttcacacacttg
gcggtgaggatccagggccactacattgtggcagggaagaccagcatctcgcctaacacc
acctacccttcccttctggaggactaccgcgtggaatacagagtgactctcactgaggac
cagctgccccacttagaggagattcacatccggggacctgtccgggatgacattgagatt
caggtgtacagacgatatggaggagaatatggggatcttacacacccagacatcaccttt
acctactttcaactgaagcagcaggcagcctgggtatggaccgctaagcgtggaccctgc
tcagtgagctgtggggcagggctgcgctgggtgacctacagctgccaggatcaagctcaa
gacaagtgggtgaagaacgtccagtgccaagggagcccacagccacctgcatggcaagag
ccttgtgtctctgccccctgctccccatattgggtagctggagacttcagcccatgtagc
gtgtcttgtggcgggggccttcgggaacggtcactgcgctgtgtagagacccaagatggc
ttcttaaagacactgccacctgcccggtgcagagcagtagctcagcagccagcagcagaa
gtggaaaactgcaactcccagccctgtcccaccaggtgggaggtgtcagaccctggccct
tgcatgtcatctgcctgtgaggcaggtctggactcaaggaatgtgacatgtgtgtccagg
gcgggtgacccggagaagccagaaactgcaggcccctgccgcaccgatgagacgtcagct
atgccggagccctgcttcaggagcctgtgttccccaggcttgggtcaggtgaactacacc
atgtctctgggagaggaggctccatccccagtgggcagtgacaagccaggggctcaggct
gagcatgtgtggacccctctggtggggctgtgctccatctcttgtgggagaggtctgaag
gaactgtatttcctgtgcatggattctgtcctcaaaatgcctgtccaggaagagctatgc
ggcttggctagtaagcccccaagccggtgggaggtctgcagggctcgcccctgtcctgct
cggtgggagactcaagccttggcaccgtgcccaatgacctgtggtggggggcgagtgcca
ctggctgttcgttgtgtgcagctagaccatggccacccagtatctgtgcctcactccaag
tgctggccagtgcctaggccaggctccttcgaggactgcagccctgagccttgtcctgct
agatggaaagtcctgtcccttggcccatgctcagccagctgtggccttggcattgccaca
caaatggtggcctgcatgcagtttgaccagggccatgacaaagagatgaatgaaactttc
tgtaaggctctagtgcggcctcaggccagtgtcccctgcctcattgctgactgcgcattc
aggtggcacatcagcgcctggacagagtgctctgtctcctgtggggacggtatccagcgc
cggcatgacacctgccttggaccccaggcccaagtgcctgtgccagacaatttctgccag
cacctgcccaaaccagtgaccgtgagaggctgctgggctggaccctgtgtagggcaggag
acctccagctcactgcctcacaaggaagctactcttcccagtcagacccaagctgctgtt
actgttgcttctctgcagtggtctgagccccaagcccagacccgcacccttttctcagcc
tcccagtctctggggctccaggaaaacctggaagagcatggtgcctgtggaaggcagtac
ctggagcccacaggaaccattcacatgcgagatcaaggacggctagactgtgtggtggcc
attgggagacctctaggtgaagtggtgaccctacaaatccttgagagctccctcaagtgt
agtgcaggggagcaactgctgctctggggtaggttcacatggaggaagacatgcaggaag
atgcctggcatgactttcagcaccaaaaccaacacagtggtggtgaagcagcatcgtgtg
ctgccagggggtggagtgctgctacggtactggagccaacctgccccggggaccttctac
aaagaatgtgacaggcagctctttggacctcggggtgaaattgtgagtcccccactgagc
ccagacgggaggaaggcagggacctgcagggtcttcatcagtgtggccccacaggcccga
attgccatccgcgccctggccagtgacatgagcactgcttctgaggggaccaatgccaac
tatgtctcgatcagggacatccacagtctgaggaccacaacattttgggggcagcaggtg
ctctactgggagtccgaaggcagcgaggctgaactggagtttagccctggcttcctggag
gcacatgccagtctccagggccagtattgggccatctcatcgaggacatcggaacaggac
gacagcctggctctgtcctag

DBGET integrated database retrieval system