KEGG   Mycoplasma canadense: MCAN360_0480Help
Entry
MCAN360_0480      CDS       T03615                                 

Gene name
trkA
Definition
(GenBank) potassium uptake protein KtrA
  KO
K03499  trk system potassium uptake protein
Organism
mcan  Mycoplasma canadense
Brite
KEGG Orthology (KO) [BR:mcan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcan02000]
    MCAN360_0480 (trkA)
Transporters [BR:mcan02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   MCAN360_0480 (trkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N TrkA_C F420_oxidored NAD_binding_10 Sacchrp_dh_NADP Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: BAP39610
UniProt: A0A077L5Q1
Position
433583..434272
Genome map
AA seq 229 aa AA seqDB search
MKLFKKAREICIIGIGRFGKAIVQKILSDRSNNIRLVLVDQEEKPLLPFKDEVDNIYIAD
CSDKKTLESLNIMECDVVIVAASDNIETVAALSEIGAKTIIARASNPRHARVLRQIGVTW
IVSPEEEAGKKTAILVSDNTLTHFSEGIVEIQDGFVSSTVFIKNSEIINKKISDTAFRSK
YDVSVSLIQRDKKFFLPSGDFQILENDLITFIGKLEDIIKVTEFCTKTK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttttaaaaaagcaagagaaatttgtattattggaataggtcgttttggtaaa
gcaattgtacagaaaatattgtcagatagatcaaataatattcgtttagttttagttgat
caagaagaaaaaccacttttaccttttaaagatgaagttgataatatttatattgccgat
tgttcagataaaaaaacattagaatcacttaatattatggaatgtgatgtagttattgta
gcggcatcagacaatatcgaaactgttgcagctttatctgaaattggtgctaaaacaatt
atagctagggcatcaaatccacgtcatgctcgtgttttgagacaaataggtgtaacttgg
atagtttctccagaagaagaagctggcaaaaaaactgctattttagtttcggataataca
ttaactcatttttctgaaggaattgtagaaatacaagatggttttgttagctcgacagta
tttattaaaaatagtgaaattattaataaaaaaattagtgatactgcattcagaagtaaa
tatgatgtttcggtttctttaattcaaagggataaaaaattctttttaccaagtggagat
tttcaaattttagaaaatgatttaataacttttataggaaaattagaagatattattaaa
gtaactgaattttgtacaaaaacaaaataa

DBGET integrated database retrieval system