KEGG   Mycoplasma capricolum subsp. capripneumoniae F38: MCCPF38_00112
Entry
MCCPF38_00112     CDS       T03703                                 

Gene name
argF_1
Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mcap  Mycoplasma capricolum subsp. capripneumoniae F38
Pathway
mcap00220  Arginine biosynthesis
mcap01100  Metabolic pathways
mcap01110  Biosynthesis of secondary metabolites
mcap01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MCCPF38_00112 (argF_1)
Enzymes [BR:mcap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     MCCPF38_00112 (argF_1)
SSDB
Motif
Pfam: OTCace_N OTCace DUF2483
Other DBs
NCBI-ProteinID: CEA11478
Position
1:122665..123501
AA seq 278 aa
MALNLKGKSFLKLLDFSPREIRYLLDLSRDLKRAKYAGNEVQTMQGKNVVLLFQKNSTRT
RCAFEVATLDQGAHVTYLGPSGSQFGKKESVADTAKVLGRMYDAIEFRGYEQSVVEDLAK
YSGVPVYNGLTNEFHPTQILADFLTVEEYKGNLKGLKFVFAGDTRNNVATSLMVGCAKMG
MHFVGAAPKELWPSEDLVNQSKEIAKETNATISFVEDMKQACSDADVIYTDVWVSMGEPA
EVWESRINLLKPFQVNMDAIKVAKPDVILCTVYHHFMI
NT seq 837 nt   +upstreamnt  +downstreamnt
atggctttaaatttaaaaggtaaaagttttttaaaattattagatttttctccaagagaa
attagatatttattagatttatctagagatttgaaaagagcaaagtatgctggtaatgaa
gttcaaacaatgcaaggaaaaaacgttgttttactatttcaaaaaaattcaactagaact
agatgtgcttttgaagtagcaacattagatcaaggtgctcacgttacttatttaggacca
tcaggatctcaatttggtaaaaaagaatcagtagcagatactgcaaaagttttaggtaga
atgtatgatgctattgaatttagaggatatgagcaaagtgttgttgaagatcttgcaaaa
tattcaggagttccagtttataatggattaactaatgaatttcacccaactcaaattctt
gcagattttttaacagttgaagaatataaaggtaatctaaaaggtctaaaatttgttttt
gcaggagatactagaaataacgtagcaacttcactaatggttggttgtgcaaaaatggga
atgcactttgtgggggctgctccaaaagaactatgaccaagcgaagatttagtaaatcaa
tctaaagaaattgcaaaagaaacaaatgctacaatttcatttgttgaagacatgaaacaa
gcatgtagtgatgctgatgtaatttatactgatgtatgagtttcaatgggtgaaccagct
gaagtatgagaatcacgtattaacttattaaaaccattccaagttaatatggatgcaatt
aaagttgctaagcctgatgtaattttatgcactgtttaccatcatttcatgatttaa

DBGET integrated database retrieval system