KEGG   Mycoplasma capricolum subsp. capripneumoniae F38: MCCPF38_00112Help
Entry
MCCPF38_00112     CDS       T03703                                 

Gene name
argF_1
Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mcap  Mycoplasma capricolum subsp. capripneumoniae F38
Pathway
mcap00220  Arginine biosynthesis
mcap01100  Metabolic pathways
mcap01110  Biosynthesis of secondary metabolites
mcap01130  Biosynthesis of antibiotics
mcap01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    MCCPF38_00112 (argF_1)
Enzymes [BR:mcap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     MCCPF38_00112 (argF_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF2483
Motif
Other DBs
NCBI-ProteinID: CEA11478
Position
1:122665..123501
Genome map
AA seq 278 aa AA seqDB search
MALNLKGKSFLKLLDFSPREIRYLLDLSRDLKRAKYAGNEVQTMQGKNVVLLFQKNSTRT
RCAFEVATLDQGAHVTYLGPSGSQFGKKESVADTAKVLGRMYDAIEFRGYEQSVVEDLAK
YSGVPVYNGLTNEFHPTQILADFLTVEEYKGNLKGLKFVFAGDTRNNVATSLMVGCAKMG
MHFVGAAPKELWPSEDLVNQSKEIAKETNATISFVEDMKQACSDADVIYTDVWVSMGEPA
EVWESRINLLKPFQVNMDAIKVAKPDVILCTVYHHFMI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaatttaaaaggtaaaagttttttaaaattattagatttttctccaagagaa
attagatatttattagatttatctagagatttgaaaagagcaaagtatgctggtaatgaa
gttcaaacaatgcaaggaaaaaacgttgttttactatttcaaaaaaattcaactagaact
agatgtgcttttgaagtagcaacattagatcaaggtgctcacgttacttatttaggacca
tcaggatctcaatttggtaaaaaagaatcagtagcagatactgcaaaagttttaggtaga
atgtatgatgctattgaatttagaggatatgagcaaagtgttgttgaagatcttgcaaaa
tattcaggagttccagtttataatggattaactaatgaatttcacccaactcaaattctt
gcagattttttaacagttgaagaatataaaggtaatctaaaaggtctaaaatttgttttt
gcaggagatactagaaataacgtagcaacttcactaatggttggttgtgcaaaaatggga
atgcactttgtgggggctgctccaaaagaactatgaccaagcgaagatttagtaaatcaa
tctaaagaaattgcaaaagaaacaaatgctacaatttcatttgttgaagacatgaaacaa
gcatgtagtgatgctgatgtaatttatactgatgtatgagtttcaatgggtgaaccagct
gaagtatgagaatcacgtattaacttattaaaaccattccaagttaatatggatgcaatt
aaagttgctaagcctgatgtaattttatgcactgtttaccatcatttcatgatttaa

DBGET integrated database retrieval system