KEGG   Mycoplasma capricolum subsp. capripneumoniae F38: MCCPF38_00133Help
Entry
MCCPF38_00133     CDS       T03703                                 

Gene name
cysS
Definition
(GenBank) Cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
mcap  Mycoplasma capricolum subsp. capripneumoniae F38
Pathway
mcap00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mcap00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MCCPF38_00133 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcap01007]
    MCCPF38_00133 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mcap03016]
    MCCPF38_00133 (cysS)
Enzymes [BR:mcap01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     MCCPF38_00133 (cysS)
Amino acid related enzymes [BR:mcap01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MCCPF38_00133 (cysS)
Transfer RNA biogenesis [BR:mcap03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MCCPF38_00133 (cysS)
 Prokaryotic Type
    MCCPF38_00133 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 DALR_2 SlyX tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: CEA11499
UniProt: A0A078N1A4
Position
1:144348..145673
Genome map
AA seq 441 aa AA seqDB search
MQLYDSLSKTKKNLNKKTINLYCCGPTVYNYIHIGNARPVILVDVLTRYLKSRNTKINYL
QNITDIDDKIILKALDNNLTELEISQKYTKAYLEDLESLNISQPDKIILISEKMNEMVKF
IKDLVDIKAAYELDGDVYFDIKKYQNEYCKLSGYKLDELISGKRIEIDSKKNYSLDFSLW
KKTQIGIKWDSFFGLGRPGWHTECVLLIDEYFNHQTIDIHVGGIDLKFPHHENERIQFIA
KNNKELADIWLHNGHLQINDEKMSKSLGNVILVKDFIKKHNKNALRWIFLITNYTQPLNI
SDDLIYQANKFFEKLTNLSKKTIQFIIKNDLEISLIKQSKYIDQFNNYMDDDLNTSLVLS
LIDSLIKQINKNILDNMSDNFNLLISSLSYILDVLGFKDVFNYKFKKEIKELFLKWQQLV
KNKEFDKADLIRKDLIEQGIL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcaactatatgattcattatctaaaacaaaaaagaatttaaataaaaaaactattaat
ttatattgttgtggacctactgtttataattacattcatataggaaatgctcgtccagtt
attttagttgatgttttaactagatatttaaaaagcagaaatactaaaattaattatcta
caaaatattacagatattgatgacaaaattattttaaaagctttagataataacttaact
gaattagaaatttctcaaaaatacactaaagcttatttagaagatttagaatctttaaat
attagtcaacctgacaaaatcattttgattagtgaaaaaatgaacgaaatggttaaattt
ataaaagatttagttgatattaaagctgcttatgagcttgatggtgatgtttattttgat
attaaaaaataccaaaatgaatattgtaaattatctggatataaattagatgaattaatt
agtggtaaaagaattgaaattgattctaaaaaaaattatagtttagattttagtttgtga
aaaaaaacccaaataggaattaaatgagattcattttttggtctaggtagacctggttga
cacactgaatgtgtgcttttaattgatgagtattttaatcatcaaactatagatattcat
gttggtggaattgatttaaaatttcctcatcatgaaaatgaaagaattcagtttattgca
aaaaataataaagagcttgctgatatttgactacataatggacatttacaaattaatgat
gaaaaaatgtctaaatctttaggcaatgtaattttagtaaaagactttattaaaaagcat
aacaaaaatgcattacgttgaatttttttaataacaaattatactcaacctttaaatata
agtgatgatttgatttatcaagctaataaattttttgaaaaattaactaatttaagcaaa
aaaacaattcaatttattattaaaaatgatttagaaattagtttgattaaacaatctaaa
tacatagatcaatttaataattatatggatgatgatttaaatacttctttagttttatct
ttaattgattcattaataaaacaaatcaataaaaatattcttgataatatgtctgataat
tttaatttattaattagttcattaagttatatattagatgttttaggatttaaagatgtg
tttaattataaatttaaaaaagaaattaaagaattatttttaaaatgacaacaattagtt
aaaaacaaagagtttgataaagcagatcttattagaaaagatttaatagaacaaggaatc
ttataa

DBGET integrated database retrieval system