KEGG   Mycoplasma capricolum subsp. capripneumoniae ILRI181: MCCPILRI181_00034Help
Entry
MCCPILRI181_00034 CDS       T03704                                 

Gene name
mtlD
Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mcar  Mycoplasma capricolum subsp. capripneumoniae ILRI181
Pathway
mcar00051  Fructose and mannose metabolism
mcar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MCCPILRI181_00034 (mtlD)
Enzymes [BR:mcar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     MCCPILRI181_00034 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: CEA10403
UniProt: A0A078MV53
Position
1:40059..41054
Genome map
AA seq 331 aa AA seqDB search
MKLIHFGAGNIGCGFIAPILKSVVSHIYFVDNNIKIVNKINNQKLIKIHTSNNKNIEITN
ISAWLLNDFYNYQNHWDQVSLITISIGVNNLKTHYFLCSKIIDYKVRNNQKLIIMCCENG
IRISSLFKTNFNNISFNIYFVDVLVDRIVSNKNILNNYLECEDYYLWIVDKTQWPNSFKQ
INNLTYRIDFDLQIVKKIYMLNGLHCSLGWFVFKNFGFNKYLYVYQAMKNSQVIEFVDNY
LNEVILVLNHKYNINLKELSEYKDQIVKRLGNNFIKDDFKRLVRNTELKLSKNERILTIL
DYAKAHNLKHNTLLLSYQNGLEYLKIEKEKT
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaatacattttggagcaggaaacattggttgtgggtttatcgctccaatttta
aaatctgtagttagtcatatttattttgttgacaataatataaaaattgttaataaaata
aataatcaaaaacttattaaaatacatacttcaaataataaaaatatagagattacaaat
attagcgcttgattattaaatgatttttataattatcaaaatcattgagatcaagttagt
ttaattactatttcaattggtgttaataatttaaaaacacattatttcttatgttcaaaa
ataatagattataaagttagaaataatcagaaattaattataatgtgttgtgaaaatggt
attagaataagtagtttatttaaaactaattttaataatataagttttaatatttatttt
gttgatgtattagtagatagaatagttagtaataaaaacattctaaataattatttagaa
tgtgaagattattatttatgaattgttgataaaactcaatgaccaaacagttttaaacaa
ataaataatttaacttatagaatcgattttgacttacaaatagttaaaaaaatttacatg
ttaaatgggttgcactgttctttaggttggtttgtttttaaaaactttggttttaataaa
tatttgtatgtgtatcaagctatgaaaaatagtcaagttatagagtttgttgataattat
ttaaatgaagttattttagttttaaatcataaatataatattaatttaaaagaattaagt
gaatataaagatcagatagttaaaagattaggtaacaattttataaaagatgattttaaa
agattagtaagaaacactgaattaaaactaagtaaaaatgagagaattctaacaatttta
gattatgcaaaagctcataacttaaaacacaatacactcttattaagttatcaaaatgga
ttagaatatttaaaaattgaaaaagaaaagacctag

DBGET integrated database retrieval system