KEGG   Mycoplasma capricolum subsp. capripneumoniae ILRI181: MCCPILRI181_00807Help
Entry
MCCPILRI181_00807 CDS       T03704                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mcar  Mycoplasma capricolum subsp. capripneumoniae ILRI181
Pathway
mcar03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mcar00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MCCPILRI181_00807 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mcar03011]
    MCCPILRI181_00807 (rplV)
Ribosome [BR:mcar03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MCCPILRI181_00807 (rplV)
  Bacteria
    MCCPILRI181_00807 (rplV)
  Archaea
    MCCPILRI181_00807 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CEA11162
UniProt: A0A078MXN9
Position
1:complement(819067..819402)
Genome map
AA seq 111 aa AA seqDB search
MEAKAKLSMIRISPRKMRLVADTIRNKAVSVAVATLKNLNKDAAEPILKLLNSAVANAVN
NNGMEADKLYVKTIFVNEGPTLKRFRPRAHGRAYEIFKRTSHVVIVVSDEK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcaaaattaagtatgattcgtatctctcctagaaaaatgagattagtt
gcagatacaatcagaaataaagctgtatcagttgcagttgctactttaaaaaatctaaat
aaagatgctgctgaaccaattttaaaattattaaattcagcagttgctaatgctgttaat
aataacggtatggaagcagataaattatatgttaaaacaatttttgttaatgaaggacca
actttaaaacgttttagacctagagctcacggtagagcatatgaaatttttaaaagaact
agtcatgttgtgattgtagttagtgatgaaaaataa

DBGET integrated database retrieval system