KEGG   Mycoplasma canis LV: AAW50_01670Help
Entry
AAW50_01670       CDS       T03936                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mcas  Mycoplasma canis LV
Pathway
mcas00450  Selenocompound metabolism
mcas00970  Aminoacyl-tRNA biosynthesis
mcas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AAW50_01670
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AAW50_01670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcas01007]
    AAW50_01670
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mcas03016]
    AAW50_01670
Enzymes [BR:mcas01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AAW50_01670
Amino acid related enzymes [BR:mcas01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AAW50_01670
Transfer RNA biogenesis [BR:mcas03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AAW50_01670
 Prokaryotic type
   Other AARSs
    AAW50_01670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AKF41128
UniProt: A0A0F6ZN99
Position
complement(448190..449737)
Genome map
AA seq 515 aa AA seqDB search
MKKFYITTPIYYASGNLHIGHLYTTTLAWTIANFKKLMGYDVRMLTGSDEHGLKIQQKAE
EMNKDPQELVDELSTKFIQMWKDFDIDYHYFWRTSNPDHKKRVQKIFSFFLKKGYIYKGE
YKGLYSVSDEEFLTETQAIKKDGKFYHPVSHKELEWISEESYFFDMKKFVPWLVEYIEEN
EEWLMPIKTKNEILSNFINVGLENLSVTRTNISWGIKVLEDPKHTLYVWLDALCNYITAL
EFDINDKDSKNFYEFWNSDNVEVVHLVGKEITRFHMIYWPIFLKALEIKQPTRIQSHGWI
LDDQGRKMSKSLNNVVDPYDLLSKYHPEMIKYFFASQISFGEDGLFDEKRFIDIVNSDLI
NNFGNLVSRTLKMKSNSFNNQSLKYFKNKNEIDIEIEGKISEFKNLFINEFEDYKVDKAL
KAAISLSDLLNKYIDLTKPWTLKEELDRLEEVLIRLLNGIYAVATMLQVVLPKKMDEVRI
ALGVEELNIKNIEDFNKFENKKQQNEFMLFERIKR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttttacataactacaccaatttattatgcaagtggtaatttacatataggt
cacttatataccactacattagcatggactatagcgaattttaaaaaacttatgggttat
gacgtaaggatgctaacgggtagtgatgagcatggattaaaaattcaacaaaaagcagaa
gaaatgaataaagatcctcaagaactagtagatgaattatcaactaaatttattcaaatg
tgaaaagacttcgatattgattatcactatttttgaagaacaagcaatcctgatcataaa
aaaagagttcagaagatttttagtttttttctaaaaaaaggttatatttacaaaggagaa
tataaaggtttatattccgttagtgatgaagagttcttgacagaaactcaagcaattaaa
aaagatggtaaattttaccacccagtaagtcataaagaacttgaatgaatttctgaagaa
agttacttttttgatatgaaaaagttcgttccatgacttgttgaatatatcgaagaaaac
gaagaatgattaatgccaataaaaactaaaaatgaaattttatctaactttattaatgta
ggtttagaaaatctttctgttacaaggactaacatatcttgaggtataaaagttctagaa
gaccctaaacacacattatatgtttgattggacgcattgtgtaattatattactgcttta
gaattcgatattaatgacaaagattcgaagaatttttatgaattttgaaattctgataat
gttgaagtagtgcatttagtaggtaaagaaataactagattccatatgatttattgacca
atttttttaaaagcattagaaattaaacaacctactaggatacaatctcatggatgaatt
ttagatgatcagggaagaaagatgtcaaaatcattgaataatgttgttgatccatatgat
cttttatctaagtaccatccagaaatgataaaatattttttcgcttcacaaataagtttt
ggagaagatggcttatttgatgaaaaaagatttattgatatagtaaattctgatttaatt
aataactttggtaatttggtttcaagaacattgaaaatgaaatctaactcatttaataat
cagtctttaaaatattttaaaaataaaaatgaaatcgatatcgaaattgaaggaaagatt
tcagaatttaaaaatctatttattaatgaatttgaagattataaagttgataaagcttta
aaagcggctatttcactaagtgatttattaaacaaatacattgatttaacgaaaccatga
actttaaaagaagagttagacagacttgaagaagttcttattagattattaaatggaatt
tatgcagttgccacaatgttgcaagtagtcttgcctaaaaaaatggatgaagttcgtatt
gctcttggtgtagaagaactaaacataaaaaacatagaggactttaataagttcgaaaat
aaaaaacaacaaaatgaatttatgttgtttgaaagaattaagaggtaa

DBGET integrated database retrieval system