KEGG   Mycoplasma canis LV: AAW50_02885Help
Entry
AAW50_02885       CDS       T03936                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mcas  Mycoplasma canis LV
Pathway
mcas03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mcas00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AAW50_02885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mcas03011]
    AAW50_02885
Ribosome [BR:mcas03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AAW50_02885
  Bacteria
    AAW50_02885
  Archaea
    AAW50_02885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Thioredoxin_15 DUF226
Motif
Other DBs
NCBI-ProteinID: AKF41341
UniProt: A0A0F6ZME2
Position
complement(747997..748341)
Genome map
AA seq 114 aa AA seqDB search
MNKQQAKAHVKLQRVSVSKAKLVANLFRGKNVDVALGILHNTSKKSSPIFIKLLNSAIAN
ATNNHGMNASKLFVKEVYVNEGPTLKRFQPRSRGNAYSIFKRTSNLSVVLEERN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaacaagcaaaagcccacgttaagttacaaagagttagcgtttctaaagct
aaattagttgcaaacttatttagaggtaaaaacgttgacgttgcattaggtatcttacac
aatacatcaaaaaaatcatcaccaattttcattaaattattaaattcagcaatagcaaat
gcaacaaataaccacggaatgaacgcatcaaaattattcgttaaagaagtttatgtaaat
gaaggtcctactcttaaaagatttcaaccaagaagtagaggtaatgcttattcgattttc
aaacgtacatctaatttatcagtagtattagaggagagaaactaa

DBGET integrated database retrieval system