KEGG   Moraxella catarrhalis 25239: MC25239_00432Help
Entry
MC25239_00432     CDS       T03381                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
mcat  Moraxella catarrhalis 25239
Brite
KEGG Orthology (KO) [BR:mcat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mcat03016]
    MC25239_00432 (truC)
Enzymes [BR:mcat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     MC25239_00432 (truC)
Transfer RNA biogenesis [BR:mcat03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    MC25239_00432 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIT42873
UniProt: A0A3A9KZ68
Position
483235..483999
Genome map
AA seq 254 aa AA seqDB search
MGDWFMPIKPDLLQILYQDACMVIINKPANMLVHRSWLDKHETCFVMQTLRNQINQHVYP
VHRLDRPTSGVLVFALDSQTAGLLAKQFENHHIQKSYLAVVRGIIGTGRIDYALKPRLDK
IADKFSNPNQAPKSAITDYQVLATTQQPFISCRRFDSSRYSLVRLTPITGRKHQLRRHMK
HIFHPIVGDTTYGDKVQNRAVLAHIGVKRLLLHAHQLQFCHPLYDEMIRIVAPLDTAFCQ
VMTAFGWSDVDLMA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattggtttatgccgattaagcctgatttattgcaaattttgtatcaagatgcg
tgcatggtgattatcaataaacctgcaaatatgttggtgcatcgctcttggctggataaa
catgaaacttgttttgtgatgcaaactttgcgtaaccaaatcaatcaacatgtctaccct
gtacatcgtcttgatagaccaacctcaggcgtattggtctttgccctagacagtcagaca
gcaggattattagccaaacaatttgagaatcatcacatccaaaaatcttacttggcggtg
gtgcgtggtattattggtactgggcggattgattatgcactaaaaccccgccttgataaa
attgccgataagtttagtaatcccaatcaagcacccaaatctgccataaccgattatcag
gttcttgccacaacgcagcaaccatttatatcgtgtcggcgttttgatagttctcgatat
tctttggttcgcttaacaccaatcacagggcgaaagcatcagttgcgtcgccatatgaag
catatttttcatcccattgttggtgataccacttatggcgataaagtgcaaaatcgtgct
gtgcttgctcatattggtgtcaaaagactgttgttgcatgctcatcagttacagttttgt
catccgttatatgatgagatgatccgtattgttgcacccttagatacggccttttgtcaa
gtaatgacagcgtttgggtggtctgatgtggacttgatggcttaa

DBGET integrated database retrieval system