KEGG   Moraxella catarrhalis 25239: MC25239_00475Help
Entry
MC25239_00475     CDS       T03381                                 

Gene name
fadI
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcat  Moraxella catarrhalis 25239
Pathway
mcat00071  Fatty acid degradation
mcat00072  Synthesis and degradation of ketone bodies
mcat00280  Valine, leucine and isoleucine degradation
mcat00310  Lysine degradation
mcat00362  Benzoate degradation
mcat00380  Tryptophan metabolism
mcat00620  Pyruvate metabolism
mcat00630  Glyoxylate and dicarboxylate metabolism
mcat00640  Propanoate metabolism
mcat00650  Butanoate metabolism
mcat00900  Terpenoid backbone biosynthesis
mcat01100  Metabolic pathways
mcat01110  Biosynthesis of secondary metabolites
mcat01120  Microbial metabolism in diverse environments
mcat01130  Biosynthesis of antibiotics
mcat01200  Carbon metabolism
mcat01212  Fatty acid metabolism
mcat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mcat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MC25239_00475 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    MC25239_00475 (fadI)
   00640 Propanoate metabolism
    MC25239_00475 (fadI)
   00650 Butanoate metabolism
    MC25239_00475 (fadI)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC25239_00475 (fadI)
   00072 Synthesis and degradation of ketone bodies
    MC25239_00475 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC25239_00475 (fadI)
   00310 Lysine degradation
    MC25239_00475 (fadI)
   00380 Tryptophan metabolism
    MC25239_00475 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC25239_00475 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC25239_00475 (fadI)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MC25239_00475 (fadI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcat04147]
    MC25239_00475 (fadI)
Enzymes [BR:mcat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MC25239_00475 (fadI)
Exosome [BR:mcat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MC25239_00475 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIT42911
Position
complement(527575..528858)
Genome map
AA seq 427 aa AA seqDB search
MSLNKVAILGGNRIPFARSNGVYADANNIDMLTAALDGLVARFDLADKQIGEVVAGTVLK
HSRDLNLTREAVLNTQLPATTPAYDISQACGTGLQAAFAVANKIALGLIDNGIAGGTDTT
SDAPIALGDGLRKPLLRLGNAKTAKQKLSALSTINPKDLLAFPQNGEPRTRLSMGEHQAI
TALEWNISRTDQDELAYNSHQNLAQAYESGFFDDLITPYKGLTKDNNLRPDTTLEKLASL
KPAFGKKNTNPTMTAGNSTPLTDGASVVLLSSDAWAKEHGHEPLAYITHQQTAAVDFIGK
EGLTEGLLMAPAYAVPKMLKRAGLTLQDFDFYEIHEAFASQVLSTLAAWEDETFCKTRLG
LDAPLGSIDRSKLNVNGSSLAAGHPFAATGGRILATAAKLLAQKGSGRALVSICAAGGQG
VVCILER
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaataaggttgccatcttaggcggtaatcgcattccttttgcgcgtagtaat
ggcgtatatgctgatgccaacaacattgatatgctcactgcagcattagatggattggtt
gctcgttttgatttggcggataaacaaattggtgaagttgtggcaggtactgtcttaaaa
cacagtcgtgacctaaacttaacccgtgaggcagtgcttaacacccaattacctgcaacg
acgcctgcttatgatatctcgcaagcctgtggtactggactacaagcagcttttgctgtg
gcaaataaaattgcgctaggccttattgataatggtattgcaggcggtacagacacaacc
tctgatgcaccgattgcattgggtgatggtctgcgtaagccgcttttgcgtttaggcaat
gccaaaacagccaagcaaaaactgtctgcacttagcaccatcaaccccaaagatttatta
gccttcccccaaaatggtgaaccacgcactcgcctttcaatgggcgaacaccaagccatc
accgcacttgagtggaatatcagtcgcaccgatcaagatgaacttgcctataacagccat
caaaacttggctcaggcgtatgaatcaggattttttgatgacttaatcacaccttataaa
ggcttgaccaaagataataatttgcgtcctgataccacacttgaaaaattagccagtcta
aaacctgcctttggcaaaaaaaataccaatccaaccatgaccgcaggtaactcaacgcca
ctcacagatggtgcttctgtggtgctactgtctagtgacgcatgggcaaaagagcatggg
catgagccacttgcttatatcactcaccagcagacagcagcggttgattttattggtaaa
gaaggtttaaccgaaggtcttttaatggcacctgcttatgccgtgcctaagatgctcaag
cgtgcaggtttgaccttgcaagattttgatttttatgaaattcatgaagcttttgcctct
caggtactttctactttggcagcttgggaagatgagactttctgtaaaactcgcttggga
ctagatgcaccactcggcagcatcgatcgcagtaagcttaatgtcaatggctcaagctta
gcagcaggtcacccctttgcagcaacaggtggacgaattttggcgacagcagccaaacta
ttggctcaaaaaggctcaggccgtgcattggtttctatttgtgctgctggtggtcagggt
gttgtgtgtatcttagagagataa

DBGET integrated database retrieval system