KEGG   Moraxella catarrhalis 25239: MC25239_01596Help
Entry
MC25239_01596     CDS       T03381                                 

Gene name
rlmA
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
mcat  Moraxella catarrhalis 25239
Brite
KEGG Orthology (KO) [BR:mcat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mcat03009]
    MC25239_01596 (rlmA)
Enzymes [BR:mcat01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     MC25239_01596 (rlmA)
Ribosome biogenesis [BR:mcat03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MC25239_01596 (rlmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Ubie_methyltran Methyltransf_23 Methyltransf_32 NodS Methyltransf_12 Methyltransf_9 MTS TPMT tRNA_U5-meth_tr Methyltransf_18 TehB PCMT PADR1 RrnaAD PrmA Methyltransf_8 FtsJ DREV
Motif
Other DBs
NCBI-ProteinID: AIT43979
Position
complement(1714806..1715609)
Genome map
AA seq 267 aa AA seqDB search
MLICPICHLSLNFTKKTYQCANQHSFDVAKGGYVNLHLVQHKKSKHPGDTPAAVQARRAF
LSAEHYQPLKSEILNMIGNIRPKTILDIGCGEGYYTQALGSICDHVIGLDIAKSAIQTAA
KADGSNQITWVVATGSVLPVADKSMNVCTSFFSPLPKDEIRRVLCDGGYLMVAVAAPNHL
YDMRAALFETVVAHHPNKSIQRLAPEFCLVDQAYITAPMHLDNTALKNLIAMTPYAYKAK
SERRAALECCESFFVQGEFCIFLFKKL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcttatctgtccaatttgtcatttatcgctaaattttacaaagaaaacctaccaatgt
gccaatcaacacagttttgatgttgccaaaggcggttatgtaaacttacacttagtacaa
cataaaaaaagtaaacatcctggtgatacgcctgctgctgtgcaagcacggcgtgcattt
ttatcagcggagcattatcaaccgctcaaatcagaaattttaaacatgattggaaatatt
cgccccaaaacgatacttgatattgggtgtggtgaaggttattatacccaagctttgggc
agcatttgtgatcatgtgattgggcttgatattgccaaatcagccattcagactgccgct
aaagctgatgggtcaaaccaaatcacttgggtggtggcaacagggtctgtattacctgtt
gctgataagtctatgaatgtgtgtaccagcttttttagtccgctaccaaaagatgaaata
cgacgagtgctttgtgatggtggctacttgatggtggcagttgctgcacccaatcatttg
tatgatatgcgtgcagcgttatttgagacggtagttgcacatcaccccaacaaatccata
caaaggcttgcacctgaattttgtttggttgaccaggcatatatcaccgcaccaatgcac
ttggataatacggctcttaaaaacttaattgctatgacgccttacgcctataaggcaaaa
tctgagcggcgtgctgcacttgaatgctgtgagagcttttttgtacaaggtgaattttgt
atatttttatttaaaaaattataa

DBGET integrated database retrieval system