KEGG   Mycolicibacterium chubuense: Mycch_0097Help
Entry
Mycch_0097        CDS       T02150                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00361  Chlorocyclohexane and chlorobenzene degradation
mcb00625  Chloroalkane and chloroalkene degradation
mcb01100  Metabolic pathways
mcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycch_0097
   00361 Chlorocyclohexane and chlorobenzene degradation
    Mycch_0097
Enzymes [BR:mcb01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Mycch_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AFM14924
UniProt: I4BCB7
Position
92172..92879
Genome map
AA seq 235 aa AA seqDB search
MTPVVRALAFDVFGTVVDWRSSVIAELEDFGTRHGVQRDWAAFADDWRAGYSPAMDRVRR
GELPWTRIDDLHRGRLVELLSAAGITVDDAGIDELNRAWHRLNPWPDAVAGLTRLKTRFV
ITTLSNGNVSLLTDMAKHAGLPWDCVLSAELFRHYKPDREVYLGCADLLGVAPEEVMMVA
AHPSDLRAARDAGLRTGFVFRPAEHGPNRTLRRPAEGEFDVLADDFCDLADQLTA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaccccggtggtgcgcgccctggccttcgacgtgttcggcaccgtcgtcgactggcgc
tcgagcgtcatcgccgaactcgaggacttcggcacccgccatggggtgcaacgtgattgg
gccgcgttcgccgacgactggcgggcggggtactccccggccatggatcgcgtccgtcgc
ggcgaactgccctggaccaggatcgacgatctgcaccgcggccggctcgtggaactgttg
tcggcggcggggatcaccgtcgacgacgccggcatcgacgaactgaaccgggcgtggcac
cgactcaacccgtggcccgatgccgtcgccggcctcacgcggttgaagacgcgcttcgtc
atcaccaccctgtccaacggcaacgtctccctgctgaccgacatggccaagcacgcgggc
ctgccgtgggactgcgtgctgtcggcggaactgttccggcactacaagcccgaccgcgag
gtctacctcgggtgcgccgacctcctcggcgtggcgcccgaggaggtgatgatggtcgct
gcacatccctccgacctgcgggcggcccgcgacgccggcctccgtaccgggttcgtcttc
cgccccgccgagcacggcccgaaccggacgctgcgcaggccggccgagggcgaattcgac
gtcctggcagacgacttctgcgacctcgccgaccagctgacagcctga

DBGET integrated database retrieval system