KEGG   Mycolicibacterium chubuense: Mycch_0230Help
Entry
Mycch_0230        CDS       T02150                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00071  Fatty acid degradation
mcb00072  Synthesis and degradation of ketone bodies
mcb00280  Valine, leucine and isoleucine degradation
mcb00310  Lysine degradation
mcb00362  Benzoate degradation
mcb00380  Tryptophan metabolism
mcb00620  Pyruvate metabolism
mcb00630  Glyoxylate and dicarboxylate metabolism
mcb00640  Propanoate metabolism
mcb00650  Butanoate metabolism
mcb00900  Terpenoid backbone biosynthesis
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01200  Carbon metabolism
mcb01212  Fatty acid metabolism
mcb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycch_0230
   00630 Glyoxylate and dicarboxylate metabolism
    Mycch_0230
   00640 Propanoate metabolism
    Mycch_0230
   00650 Butanoate metabolism
    Mycch_0230
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mycch_0230
   00072 Synthesis and degradation of ketone bodies
    Mycch_0230
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mycch_0230
   00310 Lysine degradation
    Mycch_0230
   00380 Tryptophan metabolism
    Mycch_0230
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mycch_0230
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycch_0230
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mycch_0230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcb04147]
    Mycch_0230
Enzymes [BR:mcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mycch_0230
Exosome [BR:mcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mycch_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt LysR_substrate
Motif
Other DBs
NCBI-ProteinID: AFM15056
UniProt: I4BCP9
Position
227013..228314
Genome map
AA seq 433 aa AA seqDB search
MADSNTTRRVAVLGGNRIPFARSDGAYAHASNQDMFTAVLDGLADRFNLKGEKLDAVIGG
AVLKHSRDFNLMRECVLGSSLSSYTPAFDLQQACGTGLQAAVAAADGIARGRYEVAAAGG
VDTASDAPIAFGNDLRKVLLGLRRAKSNVDRLKLAGKLPASLGVEIPVNSEPRTGMSMGE
HAAVTAKEMGIKRVDQDELAAASHRNMAAAYDRGFFDDLVSPFLGLYRDNNLRADSAPEK
LAKLKPVFGVRNGDATMTAGNSTPLTDGASVALLASEDWAAEHSLPVLAYFVDSQTAAVD
YVNGPDGLLMAPTYAVPRLLARNGLKLQDFDLYEIHEAFASVVLATLAAWESEEYCKERL
GLDAALGSIDRSKLNVNGSSLAAGHPFAATGGRIVAQMAKELAQKKVETGKPVRGLISIC
AAGGQGVTAILEA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggccgacagcaacacaacccgccgagtagccgttctcggaggcaaccggattcccttc
gcacgctccgacggcgcctacgcgcacgcgtccaaccaggacatgttcaccgccgtgctc
gacggactggccgatcgattcaacctcaagggggagaagctcgacgcggtcatcggcggc
gcggtgctcaagcacagccgcgacttcaacctgatgcgcgagtgcgtcctcggcagctcg
ctgtcgtcgtacacgccggcattcgacctgcagcaggcgtgcggcacgggcctgcaggcc
gcggtggccgcggccgacggcatcgcccgcggacgctacgaggtcgccgccgccggcggt
gtggacaccgcgtcggacgctccgatcgcgttcggcaacgacctgcgcaaggtgctgctc
gggctgcggcgggccaagtcgaacgtcgacaggctcaagctggccggcaagctgccggct
tcactgggggtcgagatcccggtcaacagcgagccgcgcacgggcatgtccatgggtgag
cacgccgcggtaaccgccaaggagatgggcatcaagcgcgtcgaccaggacgaactcgcc
gctgccagccaccgcaacatggccgccgcctacgaccggggcttcttcgacgacctggtc
tccccgttcctgggcctctaccgcgacaacaacctgcgtgcggactccgcgccggagaag
ctggccaagctcaagcccgtgttcggcgtgcgcaacggcgacgccaccatgacggcgggc
aactccaccccgctgaccgacggcgcctcggtggcgctgctggcgtcggaggactgggcc
gccgagcactcgctgcccgttctggcgtacttcgtcgacagccagaccgcggcggtcgac
tacgtcaacggacccgacggcctgctgatggcgccgacgtacgccgtgccccgcctgctg
gcccgcaacggcctgaagctgcaggacttcgacctctacgagatccacgaggccttcgcg
tcggtggtgctggccacgctggccgcctgggagtccgaggagtactgcaaggagcgcctc
ggcctggatgccgcgctcggctccatcgaccggtcgaaactcaacgtcaacggctcgtcg
ctggcggcgggccatccgttcgccgcgaccggcggccggatcgtcgcgcagatggccaag
gagctggcgcagaagaaggtcgagaccggtaaacccgtgcgcggtctgatttcgatctgc
gccgcgggcgggcagggcgtgacggccatcctcgaggcctga

DBGET integrated database retrieval system