KEGG   Mycolicibacterium chubuense: Mycch_0566Help
Entry
Mycch_0566        CDS       T02150                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mycch_0566
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Mycch_0566
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Mycch_0566
    1.1.1.-  
     Mycch_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 Pyr_redox_3 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFM15384
UniProt: I4BDM7
Position
586049..587104
Genome map
AA seq 351 aa AA seqDB search
MKAAVYHGPNKLEIADVDEPQPSPGTVKIQVGFNGICGTDLHEYYAGPIFVPTEPHPLTG
QQLPLTLGHEFSGTITAIGDGVTGWAEGDRVAVEPIYKCGHCSPCRAGNYNVCQQIGFHG
LMSDGGMAEYTVVPTSMLHRLPDNVSLELGALVEPMSVAYHAATLGDVEPGDTAMVFGAG
PIGIGLWFALRGKGLDDVFVVEPSPTRRAAIEALGAQTLDPTATDVPAFIAEHTGGDGAD
AVFDAAGVTPAVATALACVGSRRPMISVAIYEKPLETPLLNLVMNESRIQGSLCYTGADF
EAVIALMADGRYDTTGWVARIPIDDVVDAGFEALHAGKKMKVLVDPNGARA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtctaccacggaccgaacaagctcgagatcgccgacgtcgacgagccg
cagccgtcgccgggcaccgtcaagatccaggtcggattcaacgggatctgcggcaccgac
ctgcacgagtactacgccggtccgatcttcgtgcccaccgaaccgcacccgctgaccggg
cagcagctgccgctgaccctgggccacgagttctccggcaccatcaccgcgatcggcgac
ggcgtcaccggctgggcggagggtgatcgtgtcgccgtcgaaccgatctacaaatgcggc
cactgctcgccgtgccgggcgggtaactacaacgtctgccagcagatcggtttccacggc
ttgatgtccgacggcgggatggccgagtacaccgtggtgccgaccagcatgctgcacaga
ctgcccgacaacgtctcactcgaactcggcgcgctcgtcgaaccgatgtcggtcgcgtac
cacgccgccaccctcggcgacgtcgaacccggcgacaccgcgatggtgttcggtgccggc
ccgatcggcatcgggctgtggttcgcgttgcgcggcaagggactcgacgacgtgttcgtc
gtcgagccgtcaccgacccgtcgcgcggccatcgaggcgctcggcgcgcagacgctggat
ccgaccgccaccgacgtgcccgcgttcatcgccgagcacaccggaggtgacggcgccgac
gcggtgttcgacgcggcgggcgtgacgccggcggtggcgaccgcgctggcctgtgtcggg
tcacgtagaccgatgatcagcgtggcgatttacgaaaagccgctggagacaccgcttctc
aacctcgtcatgaacgagtcgcggatccagggctctctgtgctacaccggcgcggacttc
gaagcggtgatcgcgctgatggcggacggccgctacgacaccaccggctgggtggcccgg
atcccgatcgacgacgtcgtcgacgcgggcttcgaggcgctgcacgccggcaagaagatg
aaagttctcgtcgacccgaacggggcccgggcatga

DBGET integrated database retrieval system