KEGG   Mycolicibacterium chubuense: Mycch_0896Help
Entry
Mycch_0896        CDS       T02150                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00010  Glycolysis / Gluconeogenesis
mcb00052  Galactose metabolism
mcb00500  Starch and sucrose metabolism
mcb00520  Amino sugar and nucleotide sugar metabolism
mcb00521  Streptomycin biosynthesis
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01200  Carbon metabolism
Module
mcb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_0896
   00052 Galactose metabolism
    Mycch_0896
   00500 Starch and sucrose metabolism
    Mycch_0896
   00520 Amino sugar and nucleotide sugar metabolism
    Mycch_0896
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mycch_0896
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mycch_0896
Enzymes [BR:mcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mycch_0896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Acetate_kinase FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AFM15706
UniProt: I4BEJ9
Position
907112..908020
Genome map
AA seq 302 aa AA seqDB search
MSDHILALDIGGTKIAAGLVDPDGTLVHRAQLPTPDGDAETVWRAVASLVEQTLALTDRK
VTGVGVGTAGPIDVPGGTVSPINIAEWRHFPIVEHVAQLTGLPVRLGGDGLCMAMGEWWR
GAGRDSRFMLGMVISTGIGGGLVLDGAPYHGRTGNAGHVGHVVVEPGGAPCTCGGRGCVE
TVASGPHLAQWALANGWQGPPGADARELAEAAERGDPVARRAFDRGADAVARMIASVAAV
ADLDLVVVGGGVAKAGPVLFDPLREALGTYAGLDFLHNLRVVTAELGGDAGLVGAAALGR
FG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccacatcctcgcgctggacatcggtggcacgaagatcgccgccggactggtc
gaccccgacggcacgctcgtgcaccgggcgcagctgccgacgcccgacggtgacgccgag
acggtgtggcgcgccgtcgcgtcgctcgtcgagcagacgctcgccctgaccgaccggaag
gtgaccggggtgggcgtcgggacggccgggccgatcgacgtgcccggcggaaccgtcagc
cccatcaacatcgccgaatggcggcacttcccgatcgtcgagcacgtcgcgcagctgacg
ggtctgccggtgcgcctcggtggggacgggctgtgcatggcgatgggagagtggtggcgc
ggggccggccgggattcccgcttcatgctcggcatggtgatctcgacgggcatcggcggc
ggtctggtgctcgacggagcgccgtaccacggccgcaccggcaacgccggccacgtcggg
cacgtcgtcgtcgaaccgggcggtgcgccctgcacgtgtggagggcgcgggtgcgtcgag
accgtcgcgtcgggcccgcacctggcgcagtgggcgctggccaacgggtggcagggcccg
ccgggcgccgacgccagggaactggccgaagccgccgaacgcggcgacccggtggcgcgg
cgagcgttcgaccggggcgcggacgccgtcgcgaggatgatcgcctcggtggccgcagtc
gccgacctggacctggtggtcgtcgggggcggcgtggcgaaggccggtccggtgctgttc
gacccgctgcgcgaggcgctgggaacgtacgcgggcctggacttcctccacaacctgcgg
gtggtcaccgccgaactcggcggcgatgcgggcctcgtgggtgcggccgcactgggacgt
tttggctga

DBGET integrated database retrieval system