KEGG   Mycolicibacterium chubuense: Mycch_1199Help
Entry
Mycch_1199        CDS       T02150                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00020  Citrate cycle (TCA cycle)
mcb00190  Oxidative phosphorylation
mcb00650  Butanoate metabolism
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01200  Carbon metabolism
Module
mcb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycch_1199
   00650 Butanoate metabolism
    Mycch_1199
  Energy metabolism
   00190 Oxidative phosphorylation
    Mycch_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFM16007
UniProt: I4BFF0
Position
complement(1218750..1219238)
Genome map
AA seq 162 aa AA seqDB search
MTSTMRGENPYDHIGDRGGPAPVMQRSHDRPASLDNPRAPRRAGGMPNFEKYAWLFMRFS
GIVLVFLALGHLFIMLMWDNGVYRIDFNYVAQRWSSPFWQTWDLVLLWLAQLHGGNGLRT
IIADYSRKGSTKFWLNTLLALSMVFTLVLGTYVLLTFNANIS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcgacaatgcggggcgagaacccctacgaccacatcggcgaccgcggcgggccc
gcgcccgtcatgcagcgcagccacgaccggcccgccagcctcgacaatccgcgcgcgccc
cgccgcgccggcggcatgccgaacttcgagaagtacgcgtggctgttcatgcgcttctcc
ggcatcgtcctggtgttcctcgcgctcggacacctgttcatcatgctgatgtgggacaac
ggggtgtaccgcatcgacttcaactacgtcgcgcagcggtggtcatcgccgttctggcag
acctgggacctggtgttgctgtggctggctcagctgcacggcggcaacggcctgcgcacg
atcatcgccgactacagccgcaagggctccacgaagttctggctgaacacgctgctggcg
ctgtcgatggtgttcacgctggtgctgggcacctacgtgttgctgacgttcaacgcgaac
atctcttga

DBGET integrated database retrieval system