KEGG   Mycolicibacterium chubuense: Mycch_1510Help
Entry
Mycch_1510        CDS       T02150                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00500  Starch and sucrose metabolism
mcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mycch_1510
Enzymes [BR:mcb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mycch_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: AFM16310
UniProt: I4BGA3
Position
complement(1557009..1558997)
Genome map
AA seq 662 aa AA seqDB search
MIVDPKPAPEDLRRLAAAHGVATTYRNERREPVDVDADVVIRVLGLLDVDARTEADRRRE
LARLDERRRAGVLPPTTAMRVGGRPLTLPGVVSAVAEDGTQTDVADELPADLAPGWYRLQ
TRDGGESTLVAAPPQVPMAPPTWGWMLQLYALRSGQSWGIGDLGDLGEFIRWTADAHGAG
AVLLNPLHAPGPTHPVQPSPYTPSSRRFANPLALRIPDVPAYRRADANTRSEVDALRVSA
HTSRIDHDLVWAAKRDALELLWRAEGRPDPLSGTGTDGLRDWATYCALAERHGGRWRRWP
VALRDVSGPAVAAARRELGPRVAFHAWVQQQCSEQLTAVRDTARTAGMALGVLHDLAVGV
DADGADAWALADVLAGEVSIGAPPDNFTPRGQDWGLPPWRPDRLAHTGYAPVRDMLRAVL
SHADGLRIDHVAGLWRLWWIPPGDGPDRGTYVHYDAETMLAVLALEAHRAGATVVGEDLG
TVEPEVTQALADNGMLGCAVSWFTRDDTAPGEPLLASSRWPSRAAASLSTHDLPTAAGFL
RGEHVRARAELGLLDDVPAEQARADEERAEWLALLRSEGLLPAPGDGAEPEEADVIAAMH
RFLASTPSRLKLVSPYDALGEPRQPNLPGTVDEYPNWRLPLPETLEQLRTDPRIAAVTGA
FR
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcgacccgaagcccgcacccgaggatctgcgccggctggccgcggcgcacgga
gtggcgaccacctaccgcaacgagcgccgtgaaccggtggacgtcgacgccgacgtggtg
atccgggtgctcggcctgctcgacgtcgatgcccgcaccgaggccgaccggcggcgtgaa
ctggcccgtctcgacgagcggcgccgtgcgggcgtccttcctcccacgacggccatgcgc
gtcggcggccggccgctgacgctgccgggggtggtgtcggcggtggccgaggacggtacc
cagaccgatgtggcggacgagctgcccgccgatctcgcgccgggctggtaccggctgcag
acgcgcgacggcggcgagagcacgctggtggcggccccgccccaggttccgatggccccg
cccacgtggggctggatgctgcagttgtacgcgctacgctcgggacagtcctggggcatc
ggcgatctcggtgatctcggcgagttcatcagatggacggccgacgcgcacggcgcgggt
gcggtcctgctcaacccactgcacgcgcccggcccgacgcatcctgtccagccgtcgccc
tacacaccgtcgagccggcgcttcgccaatccgctggccctgcgcatccccgacgtcccg
gcataccggcgggccgacgcgaacacccgctcggaagtcgatgcgctgcgcgtgtcggcg
cacaccagccgcatcgaccatgacctggtgtgggcagccaaacgcgatgcgctggaactg
ctttggcgtgccgagggccggcccgaccccctgagcgggacgggcaccgacgggctgcgg
gactgggcgacctactgcgcgttggccgagcggcacggcggacggtggcgacggtggccc
gtcgcactgcgggacgtgtcgggtccggcagtggccgcggctcgccgtgagctcggaccg
cgggtcgcgttccacgcgtgggtgcaacagcagtgcagcgagcagttgacggccgtgcgc
gacaccgcccgcaccgcgggcatggcgctgggtgtgttgcacgacctcgccgtcggggtc
gacgcggacggcgccgacgcgtgggcgctggccgatgtgctcgccggcgaggtgagcatc
ggcgcgccgccggacaacttcacgccgcgcggccaggactggggactgccgccctggcgc
ccggaccggctggcccacaccggatatgccccggtgcgcgacatgctgcgcgcagtgctc
tcccacgccgacgggctgcgtatcgatcacgtcgccggtctgtggcgcctctggtggatt
ccacccggtgacggcccggatcgcggcacctacgtccactacgacgccgagaccatgctc
gcggtgctggcgctggaggcccaccgcgcaggggccacggtggtcggtgaggacctgggg
accgtcgagccggaggtcacgcaggcgctcgccgacaacggcatgctgggatgtgcggtc
tcgtggttcacccgcgacgacaccgcacccggagaaccgttgctggcgtcgtcgcgctgg
ccgtcacgggcggcggccagtctgtccacccacgacctgcccacggcggcgggattcctt
cggggcgagcacgtgcgggcccgcgccgagctgggtctgctcgacgacgtccccgccgag
caggccagggccgacgaggaacgggccgaatggctggcgctgctgcggtcggaggggctc
ctgcccgcccccggcgacggggccgaacccgaggaggcggacgtcatcgccgcgatgcac
cggttcttggcgtcgacaccgagccggctcaaactcgtctcgccctacgacgcgctcggc
gagccgaggcagcccaatctgcccgggaccgtcgacgagtatccgaactggcggctgccg
ttgcccgagaccctggagcaattgcgcaccgacccccggatcgccgctgtcaccggcgca
ttccggtga

DBGET integrated database retrieval system