KEGG   Mycolicibacterium chubuense: Mycch_2158Help
Entry
Mycch_2158        CDS       T02150                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00010  Glycolysis / Gluconeogenesis
mcb00520  Amino sugar and nucleotide sugar metabolism
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01200  Carbon metabolism
Module
mcb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_2158
   00520 Amino sugar and nucleotide sugar metabolism
    Mycch_2158
Enzymes [BR:mcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mycch_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF5415
Motif
Other DBs
NCBI-ProteinID: AFM16941
UniProt: I4BI34
Position
complement(2225212..2226024)
Genome map
AA seq 270 aa AA seqDB search
MTAPESAESSESPAPAGGQRRGFGIDVGGSGVKGGIVDLDTGALIGDRFKLLTPQPATPE
AVAATIAQVVAHFGWQGPLGVTYPGVVTNGIVRTAANVDKGWIGANARDVISGALGGQRV
TVLNDADAAGIAEERFGAGRDNSGVIVLLTFGTGIGSAVIHNGVLLPNTEFGHLEVGGKE
AEHRAASSVKERKGWSYERWTQEVTKVLVAVENAIWPDLFIAGGGISRKADKWIPLLTNR
TPVVAAALQNTAGIVGAAMAADFDVTATGK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccggagtcagccgagtcgtccgagtctcccgcgccggccggaggacagcgc
cgcggcttcggcatcgacgtgggcggcagcggcgtcaagggcggcatcgtcgacctcgac
accggcgcgttgatcggtgaccggttcaaactcctcacgccgcagccggccactcccgag
gcggtcgccgcgacgatcgcgcaggtcgtcgcgcacttcggctggcagggcccgctcggg
gtgacctatccgggtgtggtgaccaacggcatcgtgcgcactgccgccaacgtggacaag
ggctggatcggcgccaacgcccgcgacgtcatctccggtgcgctcggcgggcagcgcgtg
acggtgctcaacgacgccgacgcggccggaatcgccgaggagcgattcggcgccggccgg
gacaattccggcgtcatcgtgctgctgaccttcggcaccggcatcggttccgcggtgatc
cacaacggcgtgcttctgcccaacaccgaattcgggcacctcgaggtgggcggcaaggaa
gccgaacaccgggcggccagctcggtcaaggagcgcaagggctggagctacgagcgatgg
acccaggaggtcacgaaggtactcgtcgccgtcgagaacgcgatctggcccgatctgttc
atcgccggtggcggcatcagccgtaaagccgacaaatggatcccgctgctgaccaaccgc
accccggtggtggcagcggcgctgcagaacaccgcgggcatcgtcggcgcggcgatggcc
gccgacttcgacgtcacagctaccgggaagtaa

DBGET integrated database retrieval system