KEGG   Mycolicibacterium chubuense: Mycch_3527Help
Entry
Mycch_3527        CDS       T02150                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00010  Glycolysis / Gluconeogenesis
mcb00020  Citrate cycle (TCA cycle)
mcb00620  Pyruvate metabolism
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01200  Carbon metabolism
Module
mcb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_3527
   00020 Citrate cycle (TCA cycle)
    Mycch_3527
   00620 Pyruvate metabolism
    Mycch_3527
Enzymes [BR:mcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mycch_3527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFM18263
UniProt: I4BLV6
Position
complement(3721850..3723001)
Genome map
AA seq 383 aa AA seqDB search
MSAVREFLVPDLGEGLEDATITSWQVAIGDEVALNQTLCTVETNKAAVEIPSPFAGRVTE
LGGAEGQTLAVGAVLVRIETEAAAVRTPVLVGYGTDDTMDGSRRRARAIPPVRKLAAELD
VDLAHLAPGSGPDGIVTRADVLAAASATGAQEAPVDTAVTGVRLEMARRMALSRSEIPDA
NASVEVAGTELLRVRDILRDAGAEAITPFVLLLRLLVVALRRHPVLNATWLDTLDGPRVH
VHPSVHLGVGVAAPRGLLVPVVRDAQMRTTRALAEEVGRLVEAARNGTLTPTELQGSTFT
VSNFGALGLDDGVPVINHPEAAILGVGALKPRAVVVDGAVVARPTMRLTCAFDHRVADGA
QVAGFLGDLRGLIEAPELALLDL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgtgcgggagttcctggttcccgacctcggcgagggcctcgaggacgccacc
atcacgagctggcaggtcgcgatcggagacgaggtcgccttgaaccagacgctgtgcacc
gtcgagaccaacaaggccgcggtagagatccccagtccgttcgccggccgggtcaccgag
ctcggcggcgccgaggggcagacgctcgcggtcggtgcggtcctggtgcggatcgagacc
gaggccgctgccgtacgcacgccggtgctggtcgggtacggcaccgacgacacgatggac
ggcagcaggcggcgggcccgggccataccgcccgtgcgcaagctggcggccgaactggac
gtggacctggcgcacctcgcacccggatcgggaccggacggaatcgtcacccgggccgac
gtactggcggccgcgtcggccaccggcgcgcaggaagctcctgtcgacacggccgtcacg
ggcgtgcggctggagatggcacgccggatggcgttgtcgcgcagcgaaattcccgacgcg
aacgcgtccgtcgaggtagccggaaccgaactgctgcgcgtgcgggacatactccgggac
gccggagccgaggcgatcaccccgttcgtgctgctgctgcggctgctcgtggtggcactc
cgccgacaccccgtgctcaacgcgacgtggctggacacgctggacggtccgcgcgtccac
gtgcacccctcggtgcacctcggtgtcggtgtcgcggcgccgcggggattgctggtgccg
gtcgtgcgcgacgcgcagatgcgcaccacgcgggcgctcgccgaggaggtcggccgtctg
gtcgaggcggcccgcaacggcacgctcacgccgacggagctgcagggctcgacgttcacg
gtgtcgaacttcggtgcgctcggcctcgatgacggtgtccccgtgatcaaccatcccgag
gcggcgatcctcggcgtgggggcgctcaagccgcgggccgtcgtggtcgacggggccgtc
gtcgcgcgccccacgatgaggctcacgtgcgcgttcgatcatcgcgtcgccgacggcgcg
caggtggcggggttcctgggcgacctgcgagggttgatcgaggcgcccgagctggcgctg
ctcgacctgtag

DBGET integrated database retrieval system