KEGG   Mycolicibacterium chubuense: Mycch_3951Help
Entry
Mycch_3951        CDS       T02150                                 

Definition
(GenBank) pterin-4a-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00790  Folate biosynthesis
mcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mycch_3951
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcb04147]
    Mycch_3951
Enzymes [BR:mcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Mycch_3951
Exosome [BR:mcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mycch_3951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AFM18676
UniProt: I4BN19
Position
4176786..4177067
Genome map
AA seq 93 aa AA seqDB search
MAVLTDEQVDAALPELDGWERADGALRRSVKFPAFLDGIEAVRRVAEHAEAKDHHPDIDI
RWCTVSFALVTHSEGGITDKDLQMARDIDGILG
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgttgacggacgaacaggtagacgccgcactgcccgaactcgacggctgggag
cgggccgacggcgcactgcgccgctcggtcaagttcccggcgtttctcgacgggatcgag
gcggtgcgccgggtggccgagcacgcggaggccaaggaccatcatccggatatcgacatc
cgatggtgcacagtgagtttcgccctcgtgacgcactcggaaggcggcatcacggacaag
gacctgcagatggcccgcgatatcgacgggatcctcgggtag

DBGET integrated database retrieval system