KEGG   Mycolicibacterium chubuense: Mycch_4196Help
Entry
Mycch_4196        CDS       T02150                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00900  Terpenoid backbone biosynthesis
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01130  Biosynthesis of antibiotics
Module
mcb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mycch_4196
Enzymes [BR:mcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mycch_4196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AFM18913
UniProt: I4BNQ6
Position
complement(4403262..4404230)
Genome map
AA seq 322 aa AA seqDB search
MSPRDGNTATEWVPTGSVTVRVPGKVNLYLDVGDRRDDGYHELTTVFHAVSLLDEVTVRT
SDMLTVEVSGEGADSVPTDERNLAWRAAELMAEHVGRAPDVAISIDKTIPVAGGMAGGSA
DAAAVLVAMNTLWELGVPRRDLHALAAELGSDVPFALHGGTALGTGRGEELATVLARNTF
HWVLAFSRGELSTRRVFAEIDRLRASGDRTLPPRLESPEPLLAALASGDPAQLAPLLGND
LQPAALSLDSSLRRTLRAGVEAGALAGIVSGSGPTCAFLCASAGAAVDIGTELAGAGVCR
TVRVASGPVQGARVVPSPSTAG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgtctccgcgtgacggcaatacggcaaccgagtgggttcccaccgggtcggtcaccgtc
cgggtgcccggcaaagtcaacctctatctggacgtgggggatcggcgcgacgacggctat
cacgaactgaccaccgtcttccacgccgtgtccctgctcgacgaggtgaccgtccgtacg
tccgacatgctgacggtggaggtgtcgggggagggggccgactcggtgcccaccgacgaa
cgcaacctcgcgtggcgggccgccgagctgatggccgagcacgtgggccgggctcccgac
gtcgcgatctcgatcgacaagacgatcccggtggccgggggaatggcgggcggcagcgcc
gacgccgccgcggtgctggtggccatgaacacgctgtgggaactcggggtgccgcgcagg
gatctgcacgcgctggccgccgagctcggcagcgacgtgccgttcgcgctgcacggcggc
acggcgctgggcaccgggcggggcgaggagctcgcgaccgtcctcgcccgcaacaccttc
cactgggtgctggcattctcccggggcgaactgtccaccaggagggtgttcgccgagatc
gaccggctgcgtgcctccggcgaccgcacgctgccgccacggctggagagccccgagccg
ctcctggccgcgctcgcctcgggcgatccggctcagctggcgcctctgctcggcaacgat
ctgcaacccgccgccctgagcctcgactcgtcgctgcgccggaccctgcgcgccggcgtg
gaggccggcgcgctggccggcatcgtgtccggttcgggtccgacatgtgcgttcctgtgc
gcctcggcgggcgcggccgtcgacatcggcacggagctggccggcgcgggcgtgtgccgg
accgtgcgggtggccagcggcccggtccagggcgctcgcgtcgtcccgagcccctcgacc
gccggctga

DBGET integrated database retrieval system