KEGG   Mycolicibacterium chubuense: Mycch_5053Help
Entry
Mycch_5053        CDS       T02150                                 

Definition
(GenBank) nucleoside-diphosphate-sugar epimerase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mcb  Mycolicibacterium chubuense
Brite
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Mycch_5053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NAD_binding_4 NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AFM19740
UniProt: I4BR33
Position
complement(5305327..5306337)
Genome map
AA seq 336 aa AA seqDB search
MTALVIGANGYLGSHVTRQLVADGQDVRVMVREGANTIGIDDLAVTRFTGDVFADEVLRE
AMTGCDVVYYCVVDARGWLRDPTPLFRTNVEGTRHVCDVAVEPGIAGTLKKFVYTSSYVT
VGRRRGRVATESDIIDDRGVTPYVRSRVQAENLVMDYVRARALPAVAMCVSTTYGAGDWG
RTPHGAIIAGAAFGKLPFVMSGIELEAVGIDDAARALLLAAENGRVGERYLISEKMISNA
DVVRIAAEAAGVAPPGRTLPLAASYAMAALGSVKGRLTGTDERLSLGSLRLMRAEAPVNC
AKARSELGWRPRPVEQSIREAAEFWVGLRSAKRAGR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacagccctcgtcatcggcgccaacggctacctcggcagccacgtcacccggcagctc
gtcgcggacggccaggacgtccgcgtcatggtgcgcgagggcgcgaacacgatcggtatc
gacgacctcgcggtcacccggttcaccggcgacgtcttcgccgacgaggtcctgcgcgag
gcgatgaccggatgcgacgtcgtctactactgcgtcgtcgacgcgcggggctggctgcgc
gaccccacgccgctgttccgcaccaacgtcgagggcacccgccatgtctgcgacgtcgcg
gtggaaccgggtatcgccggcacgctcaagaagttcgtctacaccagcagctacgtgacg
gtcgggcgcaggcggggccgcgtggccaccgagtccgacatcatcgacgaccggggggtg
acgccctacgtccgctcgcgggtgcaggcggagaacctggtgatggactacgtgcgggcc
cgtgcgctgcccgccgtggcgatgtgcgtgtcgacgacctacggcgccggcgattgggga
cgcacgccgcacggcgcgatcatcgccggtgcggcgttcggcaagctgccgttcgtgatg
agtggcatcgagctggaagcggtgggcatcgacgacgccgcccgcgcgctgctgctggcc
gcggagaacggacgggtcggcgagcgctacctgatctcggagaagatgatctccaacgcc
gacgtcgtgcggatcgccgccgaggccgccggggtcgcaccgccgggcaggaccctgccg
ctggcggcgtcgtacgcgatggcggcgctgggcagcgtcaagggccggctgaccggcacc
gacgagcggctgtcgttgggctcgctgcgactgatgcgggccgaggcgccggtgaactgc
gccaaggcccgaagtgaactgggttggcggccaaggccggtcgagcagtcgatccgcgag
gcggccgaattctgggtcgggttgcgcagcgccaagcgcgcggggagatga

DBGET integrated database retrieval system