KEGG   Macaca mulatta (rhesus monkey): 100424944Help
Entry
100424944         CDS       T01028                                 

Gene name
GUCY1B1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04730  Long-term depression
mcc04921  Oxytocin signaling pathway
mcc04924  Renin secretion
mcc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100424944 (GUCY1B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100424944 (GUCY1B1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100424944 (GUCY1B1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100424944 (GUCY1B1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100424944 (GUCY1B1)
   04924 Renin secretion
    100424944 (GUCY1B1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100424944 (GUCY1B1)
  09154 Digestive system
   04970 Salivary secretion
    100424944 (GUCY1B1)
  09156 Nervous system
   04730 Long-term depression
    100424944 (GUCY1B1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100424944 (GUCY1B1)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100424944 (GUCY1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB 4_1_CTD
Motif
Other DBs
NCBI-GeneID: 100424944
NCBI-ProteinID: NP_001253774
Ensembl: ENSMMUG00000005447
UniProt: F7HEA7
Position
5
AA seq 619 aa AA seqDB search
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETKQDDD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgccctggagctgctggtgatccgcaattacggccccgag
gtgtgggaagacatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgactccaaaacttatgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgtttgggaagatgtttttcgtcttttgccaagaa
tctggttatgatacaatcttgcgcgtcctgggctctaatgtcagagaatttctacagaac
cttgatgctctgcacgaccaccttgctactatctacccaggaatgcgcgcaccttccttt
aggtgcactgatgcagagaagggcaaaggactcattctgcactactactcagagagagaa
ggacttcaggatattgtcattggaatcatcaaaacagtggctcaacaaatccatggcact
gaaatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaagaaaaagagtcaaaagaagaggatttttatgaagatcttgacagatttgaagaa
aatggtacccaggaatcacgcatcagcccatatacattctgcaaagcttttccttttcat
ataatatttgaccgggacctagtggtcactcagtgtggcaatgctatatacagagttctc
ccccagctccagcctgggaattgcagccttctctctgtcttctcactggttcgtcctcat
attgatattagtttccatgggatcctttcgcacatcaatacggtttttgtattgagaagc
aaggaaggattgttggatgtggagaaattagaatgtgaggatgaactgactgggactgag
atcagctgcttacgtctcaagggtcaaatgatctacttacctgaagcagatagcatactt
tttctgtgttcaccaagtgtcatgaacctggacgatttgacaaggagaggcctgtatcta
agtgacatccctctgcatgatgccacgcgcgatctcgttcttttgggagaacaatttaga
gaggaatacaaactcacccaagaactggaaatcctcactgacaggctacagctcacatta
agagccctggaagatgaaaagaaaaagacagacacattgctgtattctgtccttcctcca
tctgttgccaatgagctgcggcacaagcgtccagtgcctgccaaaagatatgacaatgtg
accatcctcttcagtggcattgtgggcttcaatgctttctgtagcaaacatgcatctgga
gaaggggccatgaagatcgtaaaccttctgaacgacctctacaccagatttgacacactg
actgattcccggaaaaacccatttgtttataaggtggagactgttggtgacaagtatatg
acagtgagtggtttaccagagccatgcattcaccatgcacgatccatctgccacctggcc
ttggacatgatggaaattgctggccaggtacaagtagatggggaatctgttcagataaca
atagggatacacactggagaggtagttacaggtgtcataggacagcggatgcctcgatac
tgtctttttggaaataccgtcaacctcacaagccgaacagaaaccacaggagaaaaggga
aaaataaatgtgtctgaatatacatacagatgtcttatgtctccagaaaattcagatcca
caattccatttggagcacagaggcccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaaacaaagcaggatgatgactga

DBGET integrated database retrieval system