KEGG   Macaca mulatta (rhesus monkey): 100425956
Entry
100425956         CDS       T01028                                 

Gene name
ZBED1
Definition
(RefSeq) zinc finger BED domain-containing protein 1
  KO
K24637  zinc finger BED domain-containing protein 1 (E3 SUMO-protein ligase ZBED1) [EC:2.3.2.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    100425956 (ZBED1)
   04121 Ubiquitin system [BR:mcc04121]
    100425956 (ZBED1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100425956 (ZBED1)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BED
    100425956 (ZBED1)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100425956 (ZBED1)
SSDB
Motif
Pfam: zf-BED Dimer_Tnp_hAT DUF4413
Other DBs
NCBI-GeneID: 100425956
NCBI-ProteinID: NP_001253637
Ensembl: ENSMMUG00000007514
UniProt: F6QDB5 G7NS07
Position
X
AA seq 694 aa
MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNT
SNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDPLAVKAGHGYDS
KKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAV
REVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLSVGSRCLKTFEVPE
ENTAETITRVLYEVFIEWGISAKVFGATTNYGKDIVKACSLLDIAVHMPCLGHTFNAGIQ
QAFQLPKLGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAM
LQRLKEQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFKQVAEMLSASRYPTIS
MVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYK
RLPFLSAFERQQVENRVVEEAKGLLDKVKDGGYRPAEDKIFPVPEEPPVKKLMRTSTPPP
TSVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPL
LPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRLAPAHVDEQVFLYENARSGAEAEPE
DQDEGEWGLDQEQVFSLGDGVSGGFFGIRDSSFL
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggagaataaaagcctggagagctcccagacagacctgaagctggtggcccacccccgc
gccaagagcaaggtgtggaagtattttggctttgacaccaatgccgagggatgcatcctg
cagtggaagaaaatctattgccgtatctgcatggcccagatcgcctactccggaaacacc
tccaacctgtcctaccacctggagaagaaccaccccgaggaattctgcgagtttgtcaag
agcaacacggagcagatgcgcgaggcctttgccaccgccttctccaagctgaagcctgag
tcgtcccagcagcccgggcaggacccgctggctgtcaaggctggccacggctacgacagc
aagaagcagcaagagctgacggccgccgtgctgggcctcatctgcgaggggctgtacccg
gcctccatcgtggacgagcccaccttcaaggtgctgttgaagacggctgacccccggtac
gagctgcccagccggaagtacatctccaccaaggccatccctgagaagtacggggccgtc
cgggaggtgatcctgaaggagctggccgaggccacctggtgtggcatctccactgacatg
tggaggagcgagaaccagaaccgtgcctacgttacgctggccgcccacttcctgggcctg
ggcgcccccaactgcctgtccgtgggctcccgctgcctgaagaccttcgaggtgcccgaa
gagaacacggcggagaccatcacgcgggtgctctacgaggtcttcatcgagtggggcatc
agcgccaaggtcttcggggccaccaccaactacggcaaggacatcgtgaaggcgtgttcc
ctgctggacatcgccgtgcacatgccctgcctgggccacaccttcaatgccggcatccag
caggccttccagctcccgaagctgggggcgttgctgtcgcgctgccgaaaactggtggag
tacttccagcagtctgctgtggccatgtacatgctctatgagaagcagaagcagcagaac
gtggcccactgcatgctggtgagcaaccgcgtctcctggtgggggagcacgctggccatg
ctgcagcgcctcaaggagcagcagttcgtcatcgccggggtcctggtggaggacagcaac
aaccaccacctgatgctggaggccagcgagtgggccaccatcgaggggctggtcgagctc
ctgcagcccttcaagcaggtggccgagatgctgtcagcctccaggtaccccaccatcagc
atggtgaagccgctgctgcacatgctcctcaacaccacgctcaacatcaaggagaccgac
tccaaggagctcagcatggccaaggaggtcatcgccaaggagctctccaagacctaccag
gagacgcctgagattgacatgtttctcaacgtcgccaccttcctggacccccgctacaag
aggctgcccttcctctctgccttcgagcggcagcaggtggagaaccgcgtagtggaagag
gccaagggcctgctggacaaggtcaaagacggcggctaccggccggccgaggacaagatc
ttcccggtgcccgaggaacctcccgtaaagaagctcatgcggacgtccacgcctccgccc
accagcgtcatcaacaacatgctggccgagatcttctgccagacgggcggcgtggaggac
caggaagaatggcacgcccaggtggtggaggagctgagcaacttcaaatcccagaaggtg
ctcggcctcaacgaagaccccctcaagtggtggtcggaccgcctggccctcttccccctg
ctgcccaaggtgcttcagaagtactggtgcgtgacagccacgcgcgtcgcgcctgagcgt
ctctttggttctgccgccaacgtggtcagcgccaagaggaaccggctggcccccgcgcac
gtggacgagcaggtgtttctgtatgagaacgcccggagtggggcagaggcagaacccgag
gaccaggatgagggggagtggggcctggaccaggagcaggtgttctccttgggggacggc
gtcagcggcggtttctttggcatcagggacagcagcttcctgtag

DBGET integrated database retrieval system