KEGG   Macaca mulatta (rhesus monkey): 100429242Help
Entry
100429242         CDS       T01028                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc01100  Metabolic pathways
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04923  Regulation of lipolysis in adipocytes
Module
mcc_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100429242 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100429242 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100429242 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    100429242 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcc01002]
    100429242 (MGLL)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100429242 (MGLL)
Peptidases [BR:mcc01002]
 Serine Peptidases
  Family S33
   100429242 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Abhydrolase_3 DLH PGAP1 Thioesterase Abhydrolase_5 LIDHydrolase DUF1350 Abhydrolase_2 DUF1057 FSH1 DUF2974
Motif
Other DBs
NCBI-GeneID: 100429242
NCBI-ProteinID: XP_014985576
Ensembl: ENSMMUG00000000168
Position
2
AA seq 329 aa AA seqDB search
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHCGRYEE
LAQMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLG
HSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKDYSGILKYSMEKASRTLQFW
IPNPFWVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLL
NAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKE
LPEVTNSVFHEINMWVSQRTATAGTASPP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaagttcccccaggcggaccccgcagagcattccctaccaggatctccct
cacttggtcaatgcagatggacagtacctcttctgcaggtactggaaacccacaggcaca
cccaaggccctcatctttgtgtcccatggagctggagagcactgtggccgctatgaagag
ctggctcagatgctgatggggctggacctgctggtgttcgcccacgaccatgttggccac
ggacagagcgaaggggagaggatggtagtgtctgacttccacgttttcgtcagagatgtg
ttgcagcatgtggattccatgcagaaagactaccctgggcttcctgtcttccttctgggc
cactccatgggaggtgccatcgccatcctcacggccgcagaaaggccgggccacttcgcc
ggcatggtactcatttcacctctggttcttgccaatcctgaatctgcaacaactttcaag
gattattcggggattttgaaatattcgatggaaaaggcatcaagaacgttacagttttgg
attccaaatcctttttgggtccttgctgcaaaagtgctcaaccttgtgctgccaaacttg
tccctcgggcccatcgactccagcgtgctctctcggaataagacagaggtcgacatttat
aactcagaccccttgatctgccgggcagggctgaaggtgtgctttggcatccagctgctg
aatgccgtctcacgggtggagcgcgccctccccaagctgacggtgcccttcctgctgctc
cagggctctgccgatcgcctgtgtgacagcaaaggggcctacctgctcatggagtcagcc
aagagccaggacaagactctcaagatttatgaaggtgcctaccacgttctccacaaagag
cttcctgaagtcaccaactccgtcttccatgaaataaacatgtgggtctctcaaaggaca
gccacggcaggaactgcgtccccaccctga

DBGET integrated database retrieval system