KEGG   Macaca mulatta (rhesus monkey): 100429258Help
Entry
100429258         CDS       T01028                                 

Gene name
OTOP3
Definition
(RefSeq) otopetrin 3
Organism
mcc  Macaca mulatta (rhesus monkey)
SSDB OrthologParalogGFIT
Motif
Pfam: Otopetrin
Motif
Other DBs
NCBI-GeneID: 100429258
NCBI-ProteinID: XP_014975803
Ensembl: ENSMMUG00000023405
UniProt: F7FA81
Position
16
AA seq 596 aa AA seqDB search
MGRGARAAAAQSRWGRASRASVSLGRTIRSAPAVGEAQETEAAPHKENRVDMGAKERAAT
DPLQQKSWLVRHFSLLLRRDRQAQKAGQLFSGLLALNVVFLGGAFICSMIFNKVAVTLGD
VWILLATLKVLSLLWLLYYVASTTRRPHAVLYQDPHAGPLWVRGSLVLFGTCTFCLNIFR
VGYHVSHMRCKSQLELVFPVIEMVFISVQTWVLWKHCKDCVQVQTNFSRCGLMLTLATNL
LLWVLAVTNDSMHREIEAELGILMEKYTGNETNTCLCLNATACEAFRRGFLMLYPFSTEY
CLICCAVLFVMWKNVGRSVASHMGAHPGTVPFHLHGAIFGLLLGLLVLLAGVCVFVLFQI
EASGSAIAYQYFTLYYAFYVAVLPAMSLACLAGTAIHGLEERELDTVKNPTRSLDVVLLM
GAALGQMGIAYFSIVAIVAKHPHELLNRLILAYSLLLILQHIAQNLFIIEGLHRRPLWEA
VPEGLARKQETEPPRRGSLLELGQGLQRASLAYIHSYSHLNWKRRALKEISLFLILCNIT
LWMMPAFGIHPEFENGLEKDFYGYQIWFTIVNFGLPLGVFYRMHSVGGLVEVYLGA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcggagcccgagcggcggctgcgcagtcccgctggggtagggcgtcgcgggca
tcggtctcacttggacggacgatccgctcagcgcccgcagtcggtgaagcacaggagact
gaagcagccccacataaggagaaccgagtggatatgggggccaaggagagagcggccacc
gacccgctccagcagaagtcctggctggtgcggcatttctccctgctgctgcggcgggac
cgacaagcccagaaggccgggcaactcttctcggggctcctggccctgaacgtggtgttc
ctgggcggggccttcatctgcagcatgatcttcaacaaggtggccgtcactctgggcgac
gtgtggatcctgctggccacgctgaaggtcctctccctgctctggcttctctactacgtg
gcaagcaccacccgccgaccacatgccgtgctgtaccaagatccccacgcggggcccctc
tgggtgcggggttccctagtgctcttcggcacctgcaccttctgcctcaacatcttccga
gtgggctaccatgtgagccacatgcgctgcaagtcacagctggagcttgtcttccctgtc
atcgagatggtcttcatcagcgtccagacctgggtgctctggaaacactgcaaagactgt
gttcaggtccagaccaacttcagtagatgtggcctgatgctgaccctggccacgaacctg
ctgctgtgggttctggccgttaccaatgactccatgcaccgagagatcgaagctgagctt
ggcatcctcatggaaaaatacacaggcaatgagaccaacacctgtctgtgcctcaatgcc
accgcgtgtgaagctttccgaaggggcttcctgatgctgtaccccttcagcactgagtac
tgcctcatctgctgtgccgtgctgtttgtcatgtggaagaatgtgggccgcagtgtggca
tcccacatgggtgcccaccctggcactgtgcccttccacctgcacggggccatcttcggg
ctgctgctgggcctgctggtgctgttggcaggcgtgtgcgtctttgtgctcttccaaatc
gaggccagtggctctgccattgcttaccagtatttcaccctctactatgccttctatgtg
gctgtgctgcccgccatgagcctggcatgcctggcaggcacagccatacatgggctggag
gagcgagagctggacacggtcaagaatcctacccgcagcctggatgtggtgctgctgatg
ggtgctgcactgggccagatgggcatcgcctatttctccattgtggccattgtggccaag
cacccgcatgagctgctcaaccgcctcatcctggcctactcgctgctgctcatcttgcag
cacatcgctcagaacctcttcatcatcgagggcctgcaccggcgcccactctgggaggca
gttcccgagggcctggcaagaaagcaggagactgagcctccccgcagaggctccctgctg
gagctgggccagggcctgcagcgggcctcactggcctacatccactcctacagccacctc
aactggaagcggcgggccctcaaggagatctcactcttcctcatcctctgcaacatcaca
ctgtggatgatgcctgcatttggcatacacccggagtttgagaatgggctagaaaaggat
ttctacggctaccagatatggttcaccatcgtcaacttcggcctgcctctgggggtcttc
taccgcatgcactctgtgggaggcctggtggaggtctacctgggggcctga

DBGET integrated database retrieval system