KEGG   Macaca mulatta (rhesus monkey): 106992831
Entry
106992831         CDS       T01028                                 

Gene name
ITGB1BP1
Definition
(RefSeq) integrin beta-1-binding protein 1 isoform X1
  KO
K20058  integrin beta-1-binding protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    106992831 (ITGB1BP1)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    106992831 (ITGB1BP1)
SSDB
Motif
Pfam: ICAP-1_inte_bdg PID DUF4015 YCII
Other DBs
NCBI-GeneID: 106992831
NCBI-ProteinID: XP_014967154
Ensembl: ENSMMUG00000018036
UniProt: F7EVM2 G7NB90
Position
13
AA seq 200 aa
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTC
AEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQA
QAICKVLSTAFDSVLTSEKP
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtttcgcaaaggcaaaaaacgacacagtagtagcagttcccaaagtagcgaaatcagt
actaagagcaagtctgtagattctagccttgggggtctttcacgatccagcacggtggcc
agcctcgacacagattccaccaaaagctcaggacaaagcaacaataattcagatacctgc
gcagaatttcgaataaaatatgttggtgccattgagaaactgaaactctctgagggaaaa
ggccttgaagggccattagacctgataaattatatagacgttgcccagcaagacggaaag
ttgccttttgttcctccagaggaagaatttattatgggagtttccaagtatggcataaaa
gtatcaacatcagatcaatatgatgttttgcacaggcatgctctctacttaataatccgg
atggtgtgttacgatgatggtctcggggcgggaaaaagcttactggctctgaagaccaca
gatgcaagcaatgaagaatacagcctgtgggtttatcagtgcaacagcctggaacaagca
caagccatttgcaaggttttatccactgcttttgactctgtattaacatctgagaaacct
tga

DBGET integrated database retrieval system