KEGG   Macaca mulatta (rhesus monkey): 106997687Help
Entry
106997687         CDS       T01028                                 

Gene name
ZC3HAV1
Definition
(RefSeq) zinc finger CCCH-type antiviral protein 1 isoform X1
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106997687 (ZC3HAV1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     106997687 (ZC3HAV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HTH_53 PARP zf-CCCH_8 WWE
Motif
Other DBs
NCBI-GeneID: 106997687
NCBI-ProteinID: XP_014990501
Ensembl: ENSMMUG00000006550
Position
3
AA seq 1025 aa AA seqDB search
MADPEVCCFITKILCAHGGRMALDALLEEIALSEPQLCEVLQVAGPDRFVVLETSGEAGI
TRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFRV
LKNHELSGLNKEELAVLLLQSDPFFMPEICKNYKGEGRQQICNQQPPCSRLHICDHFTRG
NCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRN
MAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDPSSHRASLEDTPVDDLTHKFTYL
GSQDRARPPSGSSKATDLGGTSQAGASRRFFENGSQEDLLHGNPGNTYLASNSTPAPKWK
SPTSWTNDQGARRKTVFPPTLPAALSSLGSLQTPEAVTTRKGAGLLSSDYRNINGKSGTQ
DVQPGPLFNNNADGVATDTTSTRSLNYKSTSSSQREISTPRTQDAGPASRDVQATGRITD
DAGPRVALVNGKYKGKKLGASAFVHDTPNGSSQVADKTTDVEKTGATGFGFTMAVMVEKD
KLRSGSQSLRSLVPTTPGESTASAQVSTLPQSPAALSSSNRAAVWRAQGQNCTQVPVSPA
SELTRKTTGSAQYSLSDVTSTTSSRVDDHGSKEICLDHLYKGCPFNGSCSKVHFHLPYRW
QMFIGETWTDFKPMEMIEEAYSDPRIHVCSVGSYTINFREMSCDFIPIRRLSTPSSVTKP
ANSVFTTKWIWYWKNESGTWIQYGEEKDNQKSSNIDSLYLESLYQSCPRGVVQFQAGSRN
YELSFQGMIQTNKASKTQKDVIRRPKFVSQWDVQQMKRGPDRQPAQTSSVSLTATFLPQE
DLCFLSSNKYKLSEIHHLHPEYVKVSEHFKASMKNFKIEKIKKIENLELLDKFTRKKSQM
KEEGSLLFYATSRAYVESICANNFDWTLHETHETKYGKGSYFAKDAIYSHKNCPYDAKNI
VMFVARVLVGNFIEGNVSYMSPPQPYNSFVDTRLNPSVFVIFEKDQIYPQYVIEYTDADK
ACVIS
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggaggtgtgctgcttcatcaccaaaatcctgtgcgcccacgggggccgc
atggccctggacgctttgctcgaggagatcgcgctgtctgagccgcagctctgtgaggtg
ctgcaggtagccgggcccgaccgctttgtggtgttggaaaccagcggcgaggccgggatc
acccgatcggtggtggccaccactcgagcccgggtctgccgtcgcaagtactgccagaga
ccctgcgataacctgcatctctgcaagctcaacttgctgggccggtgcaactattctcag
tcggagcggaacttatgcaaatattctcatgaggttctctcggaagagaacttcagagtc
ctgaaaaatcacgaactctctggacttaacaaagaggaattagcagtgctcctcctccaa
agtgatcctttttttatgcctgagatatgcaaaaattataagggagagggtcggcagcag
atttgtaaccagcagccaccgtgttcaagactccacatctgtgaccacttcacccgaggc
aactgtcgttttcccaactgcctccggtcccataacctgatggacagaaaggtgctggcc
atcatgagggagcacgggctgaaccccgacgtggtgcagaatatccaggacatctgcaac
agcaagcatatgcagaagaatcccccgggacccagagctccttcttcacatcgtagaaac
atggcgtatagggctagaagcaaaagccgagatcggttctttcagggcagccaagaattt
cttgcgtctgcttcagcgtctgctgagaggtcctgcacgcctagtccagatccgagcagc
cacagggcttccctggaggacacgcctgtggatgatctcacccacaagttcacgtatctg
gggagtcaggatcgcgctcggcctccctcaggctcgtccaaggctaccgatctcggagga
acaagtcaggccggagcaagccggaggtttttcgagaacggcagtcaagaggacctcttg
catggaaatccaggcaacacttaccttgcttccaattcaacaccagcccccaagtggaag
agccccacatcctggacgaacgaccaaggcgccaggagaaagaccgtatttcctcccacg
ctgcctgccgccctctcttctcttggctctctgcaaacacctgaagctgtgaccaccaga
aagggcgcaggcttgctttcctcagactacaggaacatcaatggcaaaagtggaactcag
gacgtccagcctggccctctttttaataataatgctgatggagtggccacagatacaact
tctaccagatccttaaattacaaaagcacaagcagcagtcagagagaaatatcaacacct
aggactcaggatgctggacctgcttcccgagatgttcaggccactggcagaatcacagat
gatgctggcccaagagtggcacttgttaatggtaaatacaaagggaagaaacttggggct
agtgcatttgttcacgatacaccaaatggttctagtcaagtggcagataaaactactgac
gtagaaaaaactggtgccactggttttggcttcacaatggcagtcatggtggagaaagat
aagttacgttctggaagtcagagtctgaggagcctggtccccaccacacctggggaatcc
actgcctctgcacaagtcagcactctgcctcagtcacctgctgcgctttcctcaagcaac
agagctgcagtatggagggcccaggggcagaactgcacccaggttcctgtttcccctgcc
agtgagctcacaaggaagacaacaggctctgctcagtattctttatctgatgtcacaagt
accacatcttctagggtggatgatcatggctcaaaggaaatttgtcttgaccatctgtat
aagggttgtccgtttaatggtagctgcagcaaagtccacttccatctgccttaccggtgg
cagatgtttattggtgaaacctggacggacttcaagcccatggagatgatcgaggaagcc
tactctgaccccagaatccacgtctgttctgtaggaagttatacaatcaattttcgggaa
atgagttgtgatttcattcctatccgacgcctttccactccttcttctgtcaccaagcca
gccaattctgtcttcaccaccaaatggatttggtattggaagaatgaatctggcacatgg
attcagtatggagaagagaaagacaatcagaaaagttcaaacatcgactctttatacctg
gagtctctctatcaatcctgtccgaggggagttgtgcaatttcaggcgggctcacggaac
tatgagctgagtttccaagggatgattcagacaaacaaagcttccaaaactcaaaaggat
gtcatcagaagaccaaaatttgtgtctcagtgggatgtgcagcagatgaagagagggcca
gaccgtcagccagcacagacctcgtcagtgtctttaactgcgacctttcttcctcaggag
gacctttgcttcctatcctcaaataaatacaagttatcagagatccatcatctacatcca
gaatatgtcaaagtaagtgagcattttaaagcttccatgaagaatttcaagattgaaaag
ataaagaagatcgagaacctagagctcctggataaatttacacggaagaaatcgcagatg
aaggaagaaggaagcctcctattttatgcgacaagtcgtgcctacgtggaatctatctgt
gcgaataattttgactggaccctgcatgaaactcatgaaaccaaatatggaaaaggaagt
tactttgcaaaagatgccatctattcccacaaaaattgcccatatgatgccaaaaacatc
gttatgtttgtagcccgagttctggttggaaattttattgaaggaaatgtgtcgtacatg
agccctcctcagccatacaacagctttgtggataccaggttgaatccctccgtttttgtc
atctttgagaaagatcagatttacccacaatatgtgattgaatatactgatgcagacaaa
gcctgcgtgattagttag

DBGET integrated database retrieval system