KEGG   Macaca mulatta (rhesus monkey): 574113Help
Entry
574113            CDS       T01028                                 

Gene name
TUBB
Definition
(RefSeq) tubulin beta chain
  KO
K07375  tubulin beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04145  Phagosome
mcc04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    574113 (TUBB)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    574113 (TUBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    574113 (TUBB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    574113 (TUBB)
   04147 Exosome [BR:mcc04147]
    574113 (TUBB)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     574113 (TUBB)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    574113 (TUBB)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   574113 (TUBB)
  Exosomal proteins of colorectal cancer cells
   574113 (TUBB)
  Exosomal proteins of bladder cancer cells
   574113 (TUBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 574113
NCBI-ProteinID: NP_001027985
Ensembl: ENSMMUG00000030028
UniProt: P69895 Q5TM69
Position
4
AA seq 444 aa AA seqDB search
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEDFGEEAEEEA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaatcgtgcacatccaggccggtcagtgtggcaaccagatcggtgccaagttc
tgggaggtgatcagtgatgaacatggcatcgaccccaccggcacctaccacggggacagc
gacctgcagctggaccgcatctccgtgtactacaatgaagccacaggtggcaaatatgtt
cctcgtgccatcctggtggatctagaacctgggaccatggactctgttcgctcaggtcct
tttggccagatctttagaccagacaactttgtatttggtcagtctggggcaggtaacaac
tgggccaaaggccactacacagagggggccgagctggttgattctgtcctggatgtggta
cggaaggaggcagagagctgtgactgcctgcagggcttccagctgacccactcactgggt
gggggcacaggctctggaatgggcactctccttatcagcaagatccgagaagagtaccct
gatcgcatcatgaacaccttcagtgtggttccttcacccaaagtatctgacaccgtggtc
gagccctacaatgccaccctctccgtccatcagttggtagagaacactgatgagacctat
tgcattgacaacgaggccctctatgatatctgcttccgtactctgaagctgaccacacca
acctacggggatctgaaccacctcgtctcagccaccatgagcggtgtcaccacctgcctc
cgcttccctggccagctcaatgctgacctccgcaaattggcagtcaacatggtccccttc
ccacgcctccatttctttatgcctggctttgcccctctcaccagccgtggaagccagcaa
tatcgagctcttacagtgccagaactcacccagcaggtcttcgatgccaagaacatgatg
gctgcctgtgacccccgccacggccgatacctcaccgtggctgctgtcttccgtggtcgg
atgtccatgaaggaggtcgatgagcagatgcttaacgtgcagaacaaaaacagcagctac
tttgtggaatggatccccaacaacgtcaagacagctgtctgtgacatcccacctcgtggc
ctcaagatggcagtcaccttcatcggcaacagcacggccatccaggagctcttcaagcgc
atctcggagcagttcactgccatgttccgccggaaggccttcctccactggtacacaggc
gagggcatggacgagatggagttcactgaggctgagagcaacatgaacgacctcgtctct
gagtatcagcagtaccaggatgccaccgcagaagaggaggaggatttcggtgaggaggcc
gaagaggaggcctaa

DBGET integrated database retrieval system