KEGG   Macaca mulatta (rhesus monkey): 574233Help
Entry
574233            CDS       T01028                                 

Gene name
GYS1, GYS, GYS2
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00500  Starch and sucrose metabolism
mcc01100  Metabolic pathways
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04910  Insulin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04931  Insulin resistance
Module
mcc_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    574233 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    574233 (GYS1)
   04152 AMPK signaling pathway
    574233 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    574233 (GYS1)
   04922 Glucagon signaling pathway
    574233 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    574233 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mcc01003]
    574233 (GYS1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     574233 (GYS1)
Glycosyltransferases [BR:mcc01003]
 Polysaccharide
  Storage polysaccharide
   574233 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 574233
NCBI-ProteinID: NP_001028058
Ensembl: ENSMMUG00000003911
UniProt: Q8MJ26
Position
19
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEAPTPALKKTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVALFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPSEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDSERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaagtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacgggggacgaatggggcgac
aactactacctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaagacactggattccatgaacagcaagggttgcaag
gtgtattttgggcgctggttgatcgagggaggccctctggtggtgctcctggatgtgggg
gcctcagcctgggccctggagcgctggaagggagagctctgggatacctgcaacatcgga
gtgccgtggtacgaccgcgaggccaacgatgctgtcctctttggctttctcactacctgg
ttcctgggtgagttcctcgcgcagagtgaggagaagccacacgtggttgctcacttccat
gagtggttggcaggcattggactctgcctgtgtcgtgcccggcgactgcctgtagcaacc
atcttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgctgtggacttc
tacaacaacctggagaacttcaacgtggacaaggaagcaggggagaggcagatctatcac
cgctactgcatggaaagggcggcagcccactgtgctcacgtcttcactactgtgtcccag
atcaccgccatcgaggcacagcacttgctcaagaggaaaccagatattgtgacccccaat
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaagggtgccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagcgagcag
acagtggttgccttgttcatcatgccggcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaagccgtgcgcaaacagctttgggacacggccaacacggtgaaggagaagttc
gggaggaagctttatgaatccttactggttgggagccttcctgacatgaacaagatgctg
gataaggaagacttcactatgatgaagagagccatctttgcaacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggatgactcctcagaccccatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtgaaggtgattttccacccggag
ttcctctcctccacaagccccctgctcccggtggactatgaggagtttgtccgtggctgt
caccttggggtcttcccatcctactatgagccttggggctatacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaatctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctcgaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccagcgaggcagatgcggcccaagggtaccgctacccacggccggcc
tcggtgccaccgtcgccctcgctgtcacgacactccagcccgcaccagagcgaggacgag
gaggatccccggaacgggcctctggaggaagacagcgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaacattcgtgcaccagagtggccgcgccgagcgtcctgcacc
tcctccaccagtgggagcaagcgcaactctgtggacacggccacctccagctcgctcagc
acccccagcgagcccctcagccccaccagctccctgggcgaggagcgtaactaa

DBGET integrated database retrieval system