KEGG   Macaca mulatta (rhesus monkey): 574258Help
Entry
574258            CDS       T01028                                 

Gene name
PPP3R2
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04720  Long-term potentiation
mcc04724  Glutamatergic synapse
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc05010  Alzheimer's disease
mcc05014  Amyotrophic lateral sclerosis (ALS)
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
mcc05166  HTLV-I infection
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    574258 (PPP3R2)
   04310 Wnt signaling pathway
    574258 (PPP3R2)
   04370 VEGF signaling pathway
    574258 (PPP3R2)
   04020 Calcium signaling pathway
    574258 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    574258 (PPP3R2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    574258 (PPP3R2)
   04218 Cellular senescence
    574258 (PPP3R2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    574258 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    574258 (PPP3R2)
   04660 T cell receptor signaling pathway
    574258 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    574258 (PPP3R2)
   04659 Th17 cell differentiation
    574258 (PPP3R2)
   04662 B cell receptor signaling pathway
    574258 (PPP3R2)
  Endocrine system
   04922 Glucagon signaling pathway
    574258 (PPP3R2)
   04921 Oxytocin signaling pathway
    574258 (PPP3R2)
   04924 Renin secretion
    574258 (PPP3R2)
  Nervous system
   04724 Glutamatergic synapse
    574258 (PPP3R2)
   04720 Long-term potentiation
    574258 (PPP3R2)
  Development
   04360 Axon guidance
    574258 (PPP3R2)
   04380 Osteoclast differentiation
    574258 (PPP3R2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    574258 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    574258 (PPP3R2)
  Substance dependence
   05031 Amphetamine addiction
    574258 (PPP3R2)
  Infectious diseases
   05152 Tuberculosis
    574258 (PPP3R2)
   05166 HTLV-I infection
    574258 (PPP3R2)
   05163 Human cytomegalovirus infection
    574258 (PPP3R2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    574258 (PPP3R2)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     574258 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Motif
Other DBs
NCBI-GeneID: 574258
NCBI-ProteinID: NP_001182349
Position
15
AA seq 173 aa AA seqDB search
MSTMGNEASYPAEMCAHFDNDEIKRLGRRFRKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTNGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLPDWQLQQLVDKTILILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaatgggaaacgaggccagttacccggcggagatgtgcgcccactttgacaat
gatgaaattaaaaggctgggcaggaggtttcggaagttggacttggacaaatcaggctct
ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga
gtgatcgacgtcttcgacaccaacggcgatggagaagtggacttcaaggaattcatcctg
gggacctctcagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgtttagc
atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag
atgatggtgggcaacaacctgccggactggcagctccagcagctggtcgacaaaaccatc
ctcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc
agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system