KEGG   Macaca mulatta (rhesus monkey): 574300
Entry
574300            CDS       T01028                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha precursor
  KO
K05068  interleukin 2 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574300 (IL2RA)
   04151 PI3K-Akt signaling pathway
    574300 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574300 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    574300 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    574300 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    574300 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    574300 (IL2RA)
   04659 Th17 cell differentiation
    574300 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574300 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    574300 (IL2RA)
   05162 Measles
    574300 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    574300 (IL2RA)
   04090 CD molecules [BR:mcc04090]
    574300 (IL2RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   574300 (IL2RA)
CD molecules [BR:mcc04090]
 Proteins
  574300 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 574300
NCBI-ProteinID: NP_001028089
Ensembl: ENSMMUG00000015151
UniProt: Q5MNY4
Position
9
AA seq 272 aa
MDPYLLMWGLLTFITVPGCQAELCDDDPPKITHATFKAVAYKEGTMLNCECKRGFRRIKS
GSPYMLCTGNSSHSSWDNQCQCTSSAARNTTKQVTPQPEEQKERKTTEMQSQMQLADQVS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESICKMTHGKTRWTQP
QLICTGETEPSQFPGEEEPQASPDGLPESETSRLVTTTDFRIQTEVAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKNRRTI
NT seq 819 nt   +upstreamnt  +downstreamnt
atggatccatacctgctcatgtggggactgctcacgttcatcacggtgcctggctgccag
gcagagctctgtgacgatgacccgccaaaaatcacacatgccacattcaaagccgtggcc
tacaaggaaggaaccatgttgaactgtgaatgcaagagaggtttccgcagaataaaaagc
gggtcaccctatatgctctgtacaggaaactctagccactcgtcctgggacaaccaatgt
caatgcacaagctctgctgctcggaacacaacaaaacaagtgacacctcaacctgaagaa
cagaaagaaagaaaaaccacagaaatgcaaagtcaaatgcagctggcggaccaagtgagc
cttccaggtcactgcagggaacctccaccgtgggaaaatgaagccacagaaagaatttat
catttcgtggtggggcagatggtttactaccagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcatctgcaaaatgacccacgggaagacaagatggacccagccc
cagctcatatgcacaggtgaaacggagcccagtcagtttccaggtgaagaggagcctcag
gcaagccccgacggccttcctgagagtgagacttcccgcctcgtcacaacaacagatttt
cgaatacagacagaagtggctgcaaccatggaaacgttcatatttacaacagagtaccaa
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctgctgagtgggctcacc
tggcagcggagacagaggaagaatagaagaacaatctag

DBGET integrated database retrieval system