KEGG   Macaca mulatta (rhesus monkey): 693458
Entry
693458            CDS       T01028                                 

Gene name
KLF10
Definition
(RefSeq) Krueppel-like factor 10
  KO
K09209  krueppel-like factor 10/11
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    693458 (KLF10)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    693458 (KLF10)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8
Other DBs
NCBI-GeneID: 693458
NCBI-ProteinID: NP_001253406
Ensembl: ENSMMUG00000018815
UniProt: F6ZHD6 G7MZW5
Position
8
AA seq 480 aa
MLNFGASLQQTAEERMKMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYV
ENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFK
SLSDTARPHIAAPFKEEEKSPGSAPKLPKAQATSVIRHTADAQLCNHQSCPVKAASILNY
QDNSFRRRTHLTVEAARKNIPCAAVSPNRSKCERSTVADVDEKASAALYDFSVPSSETVI
CRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPASNPVVTTVVPSTPPSQPPA
VCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQ
IDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHR
RTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgctcaacttcggtgcctctctccagcagactgcggaagaaagaatgaaaatgatttct
gaaaggccaaaagagagtatgtattcctggaacaaaactgcagagaaaagtgattttgaa
gctgtagaagcacttatgtcaatgagctgcagttggaagtctgactttaagaaatacgtt
gaaaacagaccggttacaccagtatctgatttgtcagaggaagagaatctgcttcctgga
acacctgattttcatacaatcccagcattttgtttgactccaccttacagtccttctgac
tttgaaccctctcaagtgtcaaatctgatggcaccagcgccatctactgtacacttcaag
tcactctcagatactgccagacctcacattgctgcacctttcaaagaggaagaaaagagc
ccaggatctgcccccaaactccccaaagctcaggcaacaagtgtgattcgtcatacagct
gatgcccagctgtgtaaccaccagtcctgcccagtgaaagcagccagcatcctcaactat
caggacaattcttttagaagaagaacccacctaactgttgaggctgcaagaaagaacata
ccatgtgccgctgtgtcaccaaacagatccaaatgtgagagaagcacagtggcagatgtt
gatgagaaagcaagtgctgcactttatgacttttccgtgccttcctcagagacggtcatc
tgcaggtctcagccagcccccgtgtccccacagcagaagtcagtgttggtctctccacct
gcagtatctgcagggggagtgccacctatgccagtcatctgccagatggttccccttcct
gccagcaaccctgttgtgacaacagtcgttcccagcactcctcctagccagccaccagcc
gtttgcccccctgttgtgttcatgggcacacaagtccccaaaggcgccgtcatgtttgtg
gtaccccagcccgttgtgcaaagttcaaagcctccagtggtgagcccgaatggcaccaga
ctctctcccattgcccctgctcctgggttttccccttcagcagcaaaagtcactcctcag
attgactcatcaaggataagaagtcacatctgtagccacccaggatgtggcaagacatac
tttaaaagttcccatctgaaggcccacacgaggacgcacacaggagaaaaacctttcagc
tgtagctggaaaggttgtgaaaggaggtttgcccgttctgatgaactgtccagacacagg
cgaacccacacgggtgagaagaaatttgcgtgccccatgtgtgaccggcggttcatgagg
agtgaccatttgaccaagcatgcacggcgccatctatcagccaagaaactaccaaactgg
cagatggaagtgagcaagttaaatgacattgctctacctccaacccctgctcccacacag
tga

DBGET integrated database retrieval system