KEGG   Macaca mulatta (rhesus monkey): 693520Help
Entry
693520            CDS       T01028                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00220  Arginine biosynthesis
mcc00250  Alanine, aspartate and glutamate metabolism
mcc00471  D-Glutamine and D-glutamate metabolism
mcc01100  Metabolic pathways
mcc04724  Glutamatergic synapse
mcc04727  GABAergic synapse
mcc04964  Proximal tubule bicarbonate reclamation
mcc05206  MicroRNAs in cancer
mcc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    693520 (GLS)
   00220 Arginine biosynthesis
    693520 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    693520 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    693520 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    693520 (GLS)
   04727 GABAergic synapse
    693520 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    693520 (GLS)
   05206 MicroRNAs in cancer
    693520 (GLS)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     693520 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_3 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 693520
NCBI-ProteinID: XP_014966069
UniProt: I2CUE6
Position
12
AA seq 669 aa AA seqDB search
MMRLRGSAMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRSGGRPAAGPAAAARLHPWWGG
GGWPAGPLVRGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDSPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKK
QSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDL
GTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctgcgggacctgctcctgcggtcgccagccggc
gtgagcgcgactctgcggcgggcacagcccctggtcaccctgtgccggcgtccccgaagc
gggggacggccggccgcgggcccagctgccgccgcgcgactccacccgtggtggggcggg
ggcggctggccggcggggccccttgtgcggggcctgtccagctctccctcggagatcttg
caggagctgggcaaggggagcacgcatccgcagcccggggtgtcgccacccgctgccccg
gcggcgcccggccccaaggacagccccggggagacggacgcgtttggcaacagcgagggc
aaagagctggtggcctcaggtgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcggaaggacaagagaaaatacccgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagatcttttt
aaaaaatgtgttcagagcaacattgttttgttgacacaagcctttagaagaaagtttgtc
attcctgactttatgtcttttacctcacacattgatgagttatatgaaagtgctaaaaag
cagtctggaggaaaggttgcagattatattcctcaactggccaaattcagtcctgatttg
tggggtgtgtctgtttgtacagtagatggacagaggcattctattggagataccaaagtt
cccttctgtcttcagtcctgtgtaaaacctttgaaatatgccattgctgttaatgatctt
ggaactgaatatgtgcatcgatatgttggaaaagagccgagtggactaagattcaacaaa
ctatttttgaatgaagatgataaaccacataatcctatggtaaatgctggagcaattgtt
gtgacttcactaataaagcaaggagtaaataatgctgaaaaatttgactatgtcatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcgacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaagaagtgt
tttccagaaggcacagatatggttggtatattagacttctacttccagctgtgctccatt
gaagtgacttgtgaatcagccagtgtgatggctgcgacactggctaatggtggtttctgc
ccaattactggtgaaagagtactgagccctgaagcagttcgaaatactttgagtttgatg
cattcctgtggcatgtatgacttctcagggcagtttgcttttcatgttggtcttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgttatgggtatgatgtgc
tggtctcctcctctggataagatgggcaacagtgttaagggaattcacttttgtcacgat
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaatcttttgtttgct
gcatatactggagatgtgtctgcacttcgaagatttgctttgtcagctatggacatggaa
cagcgggactatgattctagaacagcactgcatgtagctgctgcagagggtcatgttgaa
gttgttaaatttttgctggaagcctgcaaagtaaaccctttccccaaggacaggtggaat
aacactcccatggatgaagcactgcactttggacaccatgatgtatttaaaattctccaa
gaataccaagtccagtacacacctcaaggagattctgacaacgggaaggaaaatcaaacc
gtccataagaatcttgatggattgttgtaa

DBGET integrated database retrieval system