KEGG   Macaca mulatta (rhesus monkey): 693782
Entry
693782            CDS       T01028                                 

Symbol
PGAM5
Name
(RefSeq) serine/threonine-protein phosphatase PGAM5, mitochondrial isoform X1
  KO
K15637  serine/threonine-protein phosphatase PGAM5 [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04137  Mitophagy - animal
mcc04217  Necroptosis
mcc04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    693782 (PGAM5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    693782 (PGAM5)
  09143 Cell growth and death
   04217 Necroptosis
    693782 (PGAM5)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     693782 (PGAM5)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-GeneID: 693782
NCBI-ProteinID: XP_014965221
Ensembl: ENSMMUG00000015466
UniProt: H9Z621
Position
11:132545191..132554312
AA seq 289 aa
MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDP
NWDRREPLSLINLRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTL
TPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAP
IEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCR
ALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
NT seq 870 nt   +upstreamnt  +downstreamnt
atggcgttccggcaggcgctgcagctggcggcctgcgggctggcagggggctcggccgcc
gtgctcttctcggccgtggcggtagggaagccgcgcgcgggcggggacgcggagccacgc
ccggctgagccgccggcctgggcggggggcgcgcggccgggccccggcgtctgggacccc
aactgggacaggcgagaaccgctctctctgatcaacctgcggaagaggaatgtggaatct
ggggaagaagagctggcgtccaagctggaccactacaaagccaaggccacacggcacatc
ttcctcatcaggcactcccagtaccatgtggatggctccctggagaaggaccgcactctg
accccgctgggtcgggagcaggctgaactcacggggctccgcctcgcaagcttggggttg
aagtttaataaaatcgtccattcctccatgacgcgcgccatagagaccactgatatcatc
agccggcacctgccaggcgtctgcaaagtcagcacagacctgctgcgggaaggcgccccc
atcgagccagacccgcctgtgtctcactggaagccagaagctgtgcagtattacgaagac
ggagcccggattgaggccgccttccggaactacatccaccgtgcagatgccaggcaggag
gaggacagttatgagatctttatttgtcacgccaacgtcatccgctacatcgtatgcaga
gcgctgcagttccctcccgaaggctggctccggctgtcccttaacaacggcagcatcacc
cacctggtgatccgacccaatggccgagttgcgctcaggaccctcggggacacggggttc
atgcctcccgacaagatcacccggtcgtga

DBGET integrated database retrieval system