KEGG   Macaca mulatta (rhesus monkey): 693933
Entry
693933            CDS       T01028                                 

Gene name
IRF8
Definition
(RefSeq) interferon regulatory factor 8
  KO
K10155  interferon regulatory factor 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05133  Pertussis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    693933 (IRF8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    693933 (IRF8)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    693933 (IRF8)
SSDB
Motif
Pfam: IRF-3 IRF MH2
Other DBs
NCBI-GeneID: 693933
NCBI-ProteinID: NP_001252887
Ensembl: ENSMMUG00000008125
UniProt: F7HIN3 G7NPG2
Position
20
AA seq 426 aa
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKSMFRIPWKHAGKQDYNQEVDASIFKAW
AVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKC
KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQ
QPSTGVSLVTGYTAYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTK
LYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCS
GNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPL
RSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDHVFRMFPDICASHQRPFFRE
NQQITV
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtgtgaccgaaatggtggtcggcggcttcgacagtggctgatcgagcagattgacagt
agcatgtatccaggactgatttgggagaatgacgagaagagcatgttccggatcccttgg
aaacacgctggcaagcaagattataatcaggaagtggatgcctccattttcaaggcctgg
gcagtttttaaagggaagtttaaagaaggggacaaagctgaaccagccacttggaagacg
aggttacgctgtgctttgaataagagcccagattttgaggaagtgacggaccggtcccag
ctggacatttccgagccatacaaagtttaccgaattgttcctgaggaagagcaaaaatgc
aaactaggcgtggcaactgctggctgcgtgaatgaagtcacggagatggagtgcggtcgc
tctgaaatcgacgagctgatcaaggagccttctgtggacgattacatggggatgatcaaa
aggagcccttccccgccggaggcctgtcggagtcagctccttccagactggtgggcgcag
cagcccagcacaggcgtgtcgctggtgacggggtacaccgcctacgacgcgcaccattca
gcattctcccagatggtgatcagcttctactatgggggcaagctggtgggccaggccacc
accacctgccccgagggctgccgcctgtccctgagccagcctgggctacctggcaccaag
ctgtatgggcccgagggcctggagctggtgcgcttcccaccggccgacgccatccccagc
gagcgacagaggcaggtgacgcggaagctgttcgggcacctggagcgcggggtgctgctg
cacagcagccggcagggcgtgttcgtcaagcggctgtgccagggccgcgtgttctgcagc
ggcaacgccgtggtgtgcaagggcaggcccaacaagctggagcgcgacgaggtggtccag
gtcttcgacaccagccagttcttccgagagctgcagcagttttataacagccagggccgg
cttcccgacggcagggtggtgctgtgctttggggaagagtttccggatatggcccccttg
cgctccaaactcattctcgtgcagattgagcagctctatgtccggcagctggcagaagag
gctgggaagagctgtggagccggctccgtgatgcaggcccccgaggagccgccgccagac
cacgtcttccggatgtttccagatatttgtgcctcacaccagagaccgtttttcagagaa
aaccaacagatcaccgtctaa

DBGET integrated database retrieval system