KEGG   Macaca mulatta (rhesus monkey): 694070
Entry
694070            CDS       T01028                                 
Symbol
AGK
Name
(RefSeq) acylglycerol kinase, mitochondrial
  KO
K09881  acylglycerol kinase [EC:2.7.1.94]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00561  Glycerolipid metabolism
mcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    694070 (AGK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.94  acylglycerol kinase
     694070 (AGK)
SSDB
Motif
Pfam: AGK_C DAGK_cat Tim54 NAD_kinase Peptidase_S51
Other DBs
NCBI-GeneID: 694070
NCBI-ProteinID: NP_001247490
Ensembl: ENSMMUG00000021017
UniProt: I0FJR1
Position
3:167945169..168047605
AA seq 422 aa
MTVFFKTLRNHWKKTTAGLCLLTWGGHWLYGKHCDNLLRRAACQEAQEFGNQLIPPNAQV
KKATVFLNPAACKGKARTLFEKNAAPILHLSGMDVTIVKTDYEGQAKKLLELMENTDVII
VAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGETSSLSHTLFAESGNKVQHITDATL
AIVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFST
LKEWPQTHQASISYTGPTERPPSEPEETPVQRPSLYRRILRRLASYWAQPQDALSQEVSP
EVWKDVQLSTIELSITTRNNQLDPTSKEDFLNICIEPDTISKGDFITIGSRKVRNPKLHA
EGTECLQASRCTLLVPEGAGGSFSIDSEEYEAMPVEVKLLPRKLQFFCDPRKREQMLASP
TQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgacggtgttctttaaaacgcttcgaaaccattggaagaaaactacagctgggctctgc
ctgctgacctggggaggccattggctctatggaaaacactgtgataacctactaaggaga
gcagcctgtcaagaagctcaggagtttggcaatcaactcattcctcccaatgcacaagtg
aagaaggccactgtttttctcaatccggcagcttgcaaaggaaaagccaggactctattt
gaaaaaaatgctgccccgattttacatttatccggcatggatgtgactattgttaagaca
gattatgagggacaagccaagaaactcctggaactgatggaaaacacagatgtgatcatt
gttgcaggaggagatgggacactgcaggaggttgttactggagttcttcgacgaacagat
gaggctaccttcagtaagattcccattggatttatcccactgggagagaccagtagtttg
agtcataccctctttgctgaaagtggaaacaaagtccaacatattactgatgccacactt
gccattgtgaaaggagagacagttccacttgatgtcttgcagatcaagggtgaaaaggaa
cagcctgtgtttgcaatgaccggcctccgatggggatctttcagagatgctggcgtcaaa
gttagcaagtactggtatcttgggcctctaaaaatcaaagcagcccactttttcagcact
cttaaggagtggcctcagactcatcaagcctctatctcatacacgggacctacagagaga
cctcccagtgaaccagaggagacccctgtacaaagaccttctttgtacaggagaatatta
cgaaggcttgcatcctactgggcacaaccacaggatgccctttcccaagaggtgagccca
gaggtctggaaagatgtgcagctgtccaccattgaactgtccatcacaacacggaacaat
cagcttgacccgacaagcaaagaagattttctgaatatctgcattgaacctgacaccatc
agcaaaggagactttataactataggaagtcgaaaggtgagaaaccccaagctgcacgct
gagggcacggagtgtctccaagccagccggtgcaccttgcttgtccccgagggagcaggg
ggctcttttagcattgacagtgaggagtatgaagcgatgcctgtggaggtgaaactgctc
cccaggaagctgcagttcttctgtgatcctaggaagagagaacagatgctcgcaagcccc
acccagtga

DBGET integrated database retrieval system