KEGG   Macaca mulatta (rhesus monkey): 694079Help
Entry
694079            CDS       T01028                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01040  Biosynthesis of unsaturated fatty acids
mcc01212  Fatty acid metabolism
mcc03320  PPAR signaling pathway
mcc04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    694079 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    694079 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    694079 (SCD5)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     694079 (SCD5)
Lipid biosynthesis proteins [BR:mcc01004]
 Desaturase
  First
   694079 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 694079
NCBI-ProteinID: NP_001180727
Ensembl: ENSMMUG00000000866
UniProt: F6TFW3
Position
5
AA seq 330 aa AA seqDB search
MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGA
VYSLVLIPKAKPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYKAKLPLRIFLAVANSMAF
QNDIFEWSRDHRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHPDVIEKGRKLDVTDLL
ADPVVRIQRKYYKISVVLMCFAVPTLVPWYIWGESLWNSYFLASILRYTISLNVAWLVNS
AAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDL
MCWLGLATDRKRATKPMIEARKARTGDSSA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccaccgacgcggggaagatccccttctgcgacgccaaggaagaaatc
cgtgccgggctcgaaagctcggagggcggcggcggcccggagaggccaggcgcgcgcggg
cagcggcagaacatcgtctggaggaacgtcgtcctgatgagcctgctccacttgggggcc
gtgtactccctggtgctcatccccaaagccaagccgctcactctgctctgggcctacttc
tgcttcctcctggccgctctgggtgtgacagctggtgcccatcgcttgtggagccacagg
tcctacaaggccaagctgcctctgaggatatttctggctgtcgccaactccatggctttc
cagaatgacatcttcgagtggtccagggaccaccgagcccaccacaagtactcagagacg
gatgctgacccccacaatgcccgccggggcttcttcttctcccatatcgggtggctgttt
gttcgcaagcatccggatgttattgagaaggggagaaagcttgacgtcactgacctgctt
gctgatcctgtggtccggatccagagaaagtactataagatctccgtggtgctcatgtgc
tttgcggtccccacgctggtgccctggtacatctggggagagagcctgtggaattcctac
ttcttggcctctattctccgctataccatctcactcaatgtcgcctggctagtcaacagc
gccgcccacatgtatggaaaccggccctatgacaagcacatcagccctcggcagaaccca
ctcgtcgctctgggtgccattggtgaaggcttccataattaccatcacacctttcccttt
gactactctgcgagtgaatttggcttaaattttaacccaaccacctggttcattgatctc
atgtgctggctggggctggccactgaccgcaaacgggcaaccaagccgatgatcgaggcc
cggaaggccaggactggagacagcagtgcttga

DBGET integrated database retrieval system