KEGG   Macaca mulatta (rhesus monkey): 695914
Entry
695914            CDS       T01028                                 

Gene name
CYP11B2
Definition
(RefSeq) cytochrome P450 11B2, mitochondrial
  KO
K07433  steroid 11beta-monooxygenase / corticosterone 18-monooxygenase [EC:1.14.15.4 1.14.15.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00140  Steroid hormone biosynthesis
mcc01100  Metabolic pathways
mcc04925  Aldosterone synthesis and secretion
Module
mcc_M00108  C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    695914 (CYP11B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    695914 (CYP11B2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mcc00199]
    695914 (CYP11B2)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     695914 (CYP11B2)
    1.14.15.5  corticosterone 18-monooxygenase
     695914 (CYP11B2)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP11 family
   695914 (CYP11B2)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 695914
NCBI-ProteinID: NP_001180677
Ensembl: ENSMMUG00000000959
Position
8
AA seq 503 aa
MALRAKAEVCMAAPWLSLQRAQALSTRAARAPSTVLPFEAIPQRPGNRWLRLLQIWREQG
YEHLHLEVHQTFQELGPIFRYHLGGPQMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYR
QHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALRNKVLQNA
RDSVTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSATLSFLHALEVMFKSTVQLMFM
PRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQHYTGIVAELLLNAELS
LEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQALRQESLAAAASISEHPQKATT
ELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNPALFPRP
ERYNPQRWLDIRGSGKNFHNVPFGFGMRQCLGRRLAETEMLLLLHHVLKHFLVETLTKED
IKMVYSFILRPGTFPLLTFRAIN
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcactcagagcaaaggcagaggtgtgcatggcagcgccctggctgtccctgcaaagg
gcacaggcactaagcaccagagccgcccgggcccctagtacggtgctgccctttgaagcc
ataccccagcgtccaggcaacaggtggctgaggctgctgcagatctggagggagcagggt
tatgagcacctgcacctggaggtacatcagaccttccaggaactggggcccattttcaga
taccacttgggaggaccacaaatggtgtgtgtgatgctgccggaagacgtagagaagcta
cagcaggtggacagcctacatccccacaggatgagcctggagccctgggtggcctacaga
caacatcgtgggcacaaatgtggcgtgttcttgctgaatgggcctgaatggcgcttcaat
cgactgcggctgaacccagatgtgctgtcgcccaaggctgtgcagaggttcctcccgatg
gtggatgcggtggccagggacttctcccaggccctgaggaataaggtgctgcagaacgcc
cgggacagcgtgaccctggacgtccagcccagcatcttccactacaccatagaagccagc
aacttagctctttttggagagcggctgggcctggttggtcacagccccagctctgccacc
ctgagcttcctccatgccctggaggtcatgttcaaatccaccgtccagctcatgttcatg
cccaggagcctgtctcgctggaccagtcccaaggtgtggaaggagcattttgaggcctgg
gactgcatcttccagtacggcgacaactgtatccagaaaatctatcaggaactggccttc
agccgccctcagcactatacaggcatcgtggcggagctcctgttgaatgcagaactgtca
ctagaagccatcaaggccaactctatggaactcactgcagggagcgtggacacgacggcg
tttcccttgctgatgacactctttgagctggctcggaaccccgacgtgcagcaggccctg
cgccaggagagcctggccgctgccgccagcatcagtgaacatcctcagaaggcaaccacc
gagctgcccttgctgcgggcggccctcaaggagaccttgaggctctaccctgtgggtctg
tttttggagcgagtggtgagctcagacttggtgcttcagaactaccacatcccagccggg
acactggtgcaggttttcctctactcgctgggtcgcaaccccgccttgttcccgaggcct
gagcgctacaatccccagcgctggctagacatcaggggctctggaaagaacttccacaac
gtgccctttggctttggcatgcgccagtgcctggggcggcgcctggcagaaacggagatg
ctgctgctgctgcaccatgtgctgaaacacttcctggtggagacactaaccaaagaggat
ataaagatggtctacagcttcatactgaggcccggcacgttccccctcctcactttcaga
gcgatcaactag

DBGET integrated database retrieval system