KEGG   Macaca mulatta (rhesus monkey): 695975Help
Entry
695975            CDS       T01028                                 

Gene name
HADHA
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00062  Fatty acid elongation
mcc00071  Fatty acid degradation
mcc00280  Valine, leucine and isoleucine degradation
mcc00310  Lysine degradation
mcc00380  Tryptophan metabolism
mcc00410  beta-Alanine metabolism
mcc00640  Propanoate metabolism
mcc00650  Butanoate metabolism
mcc01040  Biosynthesis of unsaturated fatty acids
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc01212  Fatty acid metabolism
Module
mcc_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
mcc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mcc_M00085  Fatty acid biosynthesis, elongation, mitochondria
mcc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    695975 (HADHA)
   00650 Butanoate metabolism
    695975 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    695975 (HADHA)
   00071 Fatty acid degradation
    695975 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    695975 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    695975 (HADHA)
   00310 Lysine degradation
    695975 (HADHA)
   00380 Tryptophan metabolism
    695975 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    695975 (HADHA)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     695975 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     695975 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 695975
NCBI-ProteinID: NP_001252819
Ensembl: ENSMMUG00000004380
UniProt: I0FL67
Position
13
AA seq 763 aa AA seqDB search
MVACRAIGILSRFSAFRILRSRGYICRNFTGSSALLTRTHINYGVKGDVAVVRINSPNSK
VNTLSKELHSEFTEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLSACKTLQEVTQLS
QEAQRILEKLEKSPKPVVAAINGSCLGGGLELAISCQYRIATKDRKTVLGVPEVLLGALP
GAGGTQRLPKMVGVPAALDMMLTGRNIRADRAKKMGLVDQLVEPLGPGLKPPEERTMEYL
EEVAITFAKGLADKKISPKRNKGLVEKLTAYAMTIPFVRQQVYKKVEEKVRKQTKGLYPA
PLKIIDVVKTGIEQGSDAGYLSESQKFGELVMTKESKALMGLYHGQVLCKKNKFGAPQKD
VKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLTGLDRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLKEVEAVIPDHCIFASNTSALP
ISEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSRDTSASAVAVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVA
EDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLK
LPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRF
VDLYGAQTIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctgccgggcaattggcatcctcagccgcttctctgccttcaggatcctccgc
tcccgaggttatatatgccgcaattttacaggatcttctgctttgctgaccagaacccat
attaactatggagtcaaaggggatgtggcagttgttcgaattaactctcccaattcaaag
gtaaatacactaagtaaagagctgcattcagaattcacagaagttatgaatgaaatctgg
gctagtgatcaaatcagaagtgccgtccttatctcatcaaagccaggctgctttattgca
ggtgctgatatcaacatgttatccgcttgcaagacccttcaagaagtaacacagctctca
caagaagcacagagaatattagagaaacttgaaaagtccccaaagcctgttgtggctgcc
atcaatggatcctgcctgggaggaggacttgagcttgccatttcatgccaatacagaata
gcaacaaaagacagaaaaacagtattaggtgtccctgaagtcttgctgggggccttacca
ggagcaggaggcacacaaaggctgcccaaaatggtgggtgtgcctgctgccttggacatg
atgctgactggtagaaacattcgtgcagacagggcaaagaaaatgggattggttgaccaa
ttagtggaacccctgggaccaggactaaaacctccagaggaacggacaatggaataccta
gaagaggttgcaattacttttgccaaaggactagctgataagaagatttctccaaagaga
aacaagggattggtggagaaattgacagcgtatgccatgactattccatttgtcaggcaa
caggtttacaaaaaagtggaagaaaaagtgcgaaagcagactaaaggcctatatcctgca
cctctgaaaataattgatgtggtaaagactggaattgagcaagggagtgatgctggttat
ctctctgaatctcagaaatttggagagcttgtaatgaccaaagaatcaaaggccttgatg
ggactctaccatggtcaggtcctgtgcaagaagaataaatttggagctccacagaaggat
gttaagcatctggctattcttggtgcagggctgatgggagcaggcatcgcccaagtctcc
gtagataaggggctaaagactatacttaaagatgccaccctcactgggctagaccgagga
cagcaacaagtgttcaaaggattaaatgacaaagtgaagaagaaagctctaacatcattt
gaaagggattccatcttcagcaacttgactgggcagcttgattaccaaggttttgaaaag
gccgacatggtgattgaagctgtgtttgaggaccttagtcttaagcacagagtgctaaag
gaagtagaagcggtgattccagatcactgtatctttgccagtaacacatctgctctccca
atcagtgaaattgctgctgtcagcaaaagacctgagaaggtgatcggcatgcactacttc
tctcccgtggacaagatgcagctgctggagattatcacgactgagaaaacttccagagac
accagtgcttcagctgtagcagtcggtctcaagcaggggaaggtcatcattgtggttaag
gatggacctggcttctatactaccaggtgccttgcgcccatgatgtctgaagtcatccga
atcctccaggaaggagttgacccgaagaagctggattccctgaccacaagttttggcttt
cctgtgggtgccgccacactggtggatgaagttggcgtggatgtagcaaaacatgtggcg
gaagatctgggcaaagtctttggggagcggtttggaggcggaaacccagaactgctgaca
cagatggtgtccaagggcttcctaggtcgcaagtctgggaagggcttttacatctatcag
gagggtgtgaagaggaaggatttgaattctgacatggatagtattttagcgagtctgaag
ctgcctcctaagtctgaagtctcctcagatgaagacatccagttccgcctggtgacaaga
tttgtgaatgaggcagtcatgtgcctgcaagaggggatcttggccacacctgcggaggga
gacatcggagccgtctttgggcttggcttcccgccttgtcttggagggcctttccgcttt
gtggatctgtatggcgcccagacgatagtggaccggctcaagaagtatgaagctgcctat
ggaaaacagttcaccccatgccagctgctagctgaccatgctaacagccccaacaagaag
ttctaccagtga

DBGET integrated database retrieval system