KEGG   Macaca mulatta (rhesus monkey): 696043Help
Entry
696043            CDS       T01028                                 

Gene name
UROS
Definition
(RefSeq) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00860  Porphyrin and chlorophyll metabolism
mcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    696043 (UROS)
Enzymes [BR:mcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     696043 (UROS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 696043
NCBI-ProteinID: NP_001253711
Ensembl: ENSMMUG00000008539
UniProt: H9FZC1
Position
9
AA seq 265 aa AA seqDB search
MKVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYGGLI
FTSPRAVEAAQLCLEKNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGETCG
NAEKLAEYICSRESSALPLLFPCGNLKREILPKALKDKGIAMESVTVYQTIPHPGIQGNL
NSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAIGPTTARALAAQGLPVS
CTAESPTPQALATGIRKALQPHGCC
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcttttactgaaggatgctaaggaagacgactgtggccaggatccgtatatc
agggaattaggattatatggacttgaagccactctgatccctgttttatcatttgaattt
ttgtctcttcccagtttctctgagaagctttctcatcctgaagattacgggggactcatt
tttaccagccccagagcagtggaagcggcacagttatgtttggagaaaaacaataaaact
gaagtctgggaaaggtctctgaaagaaaaatggaatgccaagtcagtgtatgtggttgga
aatgctactgcttctctagtgagtaaaattggcctggatacagaaggagaaacctgtgga
aatgcagaaaagcttgcagaatatatttgttccagggagtcctcagcactgcctcttcta
tttccctgtggaaacctcaaaagagaaatcctgccgaaagcgctcaaggacaaagggatt
gccatggaaagcgtaactgtgtatcagacaattccacacccaggaatccaagggaacctg
aacagctactattcccagcagggggttccagccagcatcacatttttcagtccctctggc
ctcacatacagtctcaagcatattcaggagttatctggtgacaatatcgatcaaattaag
tttgcagccatcggccccactacggctcgcgcgctggccgcccagggcctgcctgtaagc
tgcactgcagagagccccacgccacaagccctggccactggcatcaggaaggcactccag
ccccatggctgctgctga

DBGET integrated database retrieval system