KEGG   Macaca mulatta (rhesus monkey): 696308
Entry
696308            CDS       T01028                                 
Symbol
PRKG2
Name
(RefSeq) cGMP-dependent protein kinase 2 isoform X1
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04730  Long-term depression
mcc04740  Olfactory transduction
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    696308 (PRKG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    696308 (PRKG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    696308 (PRKG2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    696308 (PRKG2)
   04924 Renin secretion
    696308 (PRKG2)
  09154 Digestive system
   04970 Salivary secretion
    696308 (PRKG2)
  09156 Nervous system
   04730 Long-term depression
    696308 (PRKG2)
  09157 Sensory system
   04740 Olfactory transduction
    696308 (PRKG2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    696308 (PRKG2)
   04714 Thermogenesis
    696308 (PRKG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    696308 (PRKG2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     696308 (PRKG2)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PKG family
   696308 (PRKG2)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Kinase-like RNase_Y_N APH UPF0242 FeoB_N ABC1 MPS2 FAM76 DUF5955 NPV_P10 ATG16 Fib_alpha
Other DBs
NCBI-GeneID: 696308
NCBI-ProteinID: XP_014993921
Position
5:52486998..52609784
AA seq 762 aa
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYNLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLQRELNGPIDHSYFDKYPPEKGMPPDELSGWDKDF
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacctaaacattccaagcacccagatggacactctgggaac
ctcaccactgacgctctgcggaacaaggtgacagagctggagagagagttgaggaggaag
gatgctgagatccaggagcgggagtacaatttgaaggagctgcgggagcagctgtcgaag
cagaccgtggccattgctgaactcacagaagagctccagaacaagtgcatccagctgaac
aagctgcaggatgtggtgcatatgcagggaggaagcccgcttcaggcttctccagataaa
gtgcctcttgaggtccaccggaagacctctggattggtctctctccatagcaggagggga
gcaaaggctggcgtgtctgctgagccaacaacccggacctatgacctcaacaaaccccct
gaattttcctttgagaaagcaagagtcagaaaagactccagtgagaagaagctcattaca
gacgcccttaataaaaatcagtttctgaaaagactggatcctcagcagatcaaagacatg
gtggaatgcatgtatgggagaaactatcagcaagggagttacattattaagcaaggagaa
ccaggaaaccatatctttgtgctggcagagggtcgactagaggtgtttcaaggggagaaa
ttgctgtcctccatccctatgtggaccacatttggggagcttgccattttatacaactgt
acaaggactgcctctgtgaaagctattaccaatgttaaaacatgggcactagatcgagag
gtattccagaatataatgaggagaacagcccaagctagagatgaacaatacagaaacttc
ctcagaagtgtatccttgctgaagaatttacctgaagataaattaaccaagatcattgac
tgcttggaagtggaatactatgataaaggagattacatcattagagagggcgaggaagga
agtacctttttcattttggcaaaaggaaaggtaaaagtaacacagagtacagaaggccat
gatcaaccacagctgataaaaacactgcagaaaggagaatactttggagaaaaagctctt
atcagtgatgatgtcaggtcagctaacattattgctgaagaaaatgatgttgcatgcctg
gttatagatcgagaaacattcaaccaaactgttggtacatttgaagagctgcaaaaatac
cttgaaggatatgtggcaaacctgaaccgtgatgatgaaaaaagacatgcaaagcggtcc
atgtctaactggaagctgtccaaagcactctctctggaaatgattcagctgaaggagaag
gtggccagattttcctcatcatccccattccagaaccttgagattattgcaacactgggc
gttggtgggttcggaagagttgagcttgttaaagtaaaaaatgagaatgtcgcttttgct
atgaagtgtataaggaagaagcacatagttgacaccaagcagcaggagcatgtctactca
gagaagaggatcttagaggagctgtgctctccattcattgtgaaattatatcgtactttc
aaggacaataagtatgtatacatgcttctggaggcctgcttaggtggggagctatggagt
atattaagggacagaggcagctttgatgaacccacctccaaattctgcgttgcttgtgtg
acagaagcatttgattacctgcatcgactaggtattatctacagagacttaaaaccagaa
aacttaattctagatgctgagggttaccttaaattggttgactttggatttgcgaagaaa
atagggtctggacagaaaacatggacattctgtgggactccagaatatgtagctcctgaa
gtcattctcaacaaaggacatgacttcagtgtggatttctggtcactgggaattctagtg
tatgagcttctaacgggcaacccacccttttctgggattgaccaaatgatgacctacaat
ttgattctcaaaggaattgaaaaaatggattttcccaggaagataacacgacgacctgag
gatttgattcgaaggctttgcaggcaaaatccaacagaaaggctgggaaatctgaagaat
ggaataaatgacattaagaaacacaggtggttaaatggttttaattgggagggactgaaa
gcacggagccttccatcgcctttacaaagagagctcaatggacccatagatcacagctac
tttgacaaataccctcctgaaaagggaatgcctccagatgagctatcaggctgggataaa
gacttctga

DBGET integrated database retrieval system